Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|50
Gene name
LocationContig_10:6553..7867
Strand-
Gene length (bp)1314
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11566 PI31_Prot_N PI31 proteasome regulator N-terminal 1.0E-38 27 184
PF08577 PI31_Prot_C PI31 proteasome regulator 4.4E-13 264 324

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6059
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|50 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5913
Ophiocordyceps camponoti-floridani Ophcf2|03083
Ophiocordyceps kimflemingae Ophio5|4113
Ophiocordyceps subramaniannii Hirsu2|2225

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|50
MPSLPAAGAVLQAMAAALPTHPPTDDSSDLASSYEAVALLLHAYLTARGFVLVSLDQDKLNEECTSLAPRLPSSW
NSSFGAYTLVYILPPSTRRLVILVNRIASRVEVRALVHGLDRISRLESAVRDIVATNGLPVRIPITNGQEDRGDA
LVDRLRRIFTSEAVLTSFLQSLDEAIVQPILPQLTGQDADSSQGDATARAERLASEASHLNLAPRSTIPPPSTAD
HLPPPARPTADFAPPDFEDEHQMLPRPTTLPDGTSPFNIGADDLYPPGLGPHDPLRPGFTPGPSQGMHPSFDHPL
FAGRGRRVQDPQHPFGARYDPVGPGDESLWGGSSGRAFGPRGQGPFGRGGDPFGGGAPFGGGGGGII*
Coding >OphauG2|50
ATGCCTTCACTTCCAGCCGCCGGGGCCGTGCTGCAAGCCATGGCCGCCGCCCTGCCCACCCATCCTCCCACCGAC
GACTCGTCCGACCTGGCCAGCTCCTACGAGGCTGTTGCTCTGCTTCTTCACGCTTACCTCACTGCCCGGGGCTTT
GTGCTCGTCAGCCTTGACCAAGACAAGCTCAACGAAGAATGCACCTCTCTCGCCCCTCGCCTCCCCTCGTCATGG
AACTCGAGCTTTGGAGCCTATACCCTCGTCTACATTCTCCCTCCCTCCACCCGCCGCCTCGTCATTCTCGTCAAC
CGCATCGCCTCTCGCGTCGAGGTGCGCGCTCTGGTTCACGGCCTCGACCGCATTTCTCGCCTTGAAAGCGCTGTG
CGCGACATTGTCGCTACAAACGGCCTGCCTGTGCGCATACCCATCACCAACGGCCAAGAAGACAGAGGAGACGCC
TTGGTTGACAGACTGCGCCGCATCTTTACCTCTGAGGCGGTGCTTACATCCTTCTTACAAAGCCTCGACGAAGCC
ATTGTACAACCCATCCTCCCACAGCTCACCGGACAAGACGCAGACTCGTCCCAAGGCGACGCCACAGCCCGCGCC
GAGCGTCTCGCCTCTGAAGCCTCTCATCTCAACCTTGCTCCCCGCTCCACCATTCCCCCTCCCAGCACAGCAGAC
CATCTTCCTCCTCCCGCCCGTCCCACCGCAGACTTTGCTCCTCCCGACTTTGAGGACGAACACCAAATGCTTCCG
CGGCCCACTACTTTGCCCGACGGCACCTCCCCATTTAACATTGGCGCAGACGACTTGTACCCTCCAGGCCTCGGC
CCTCACGACCCTCTGCGCCCTGGCTTTACGCCCGGCCCCTCACAAGGCATGCATCCATCCTTTGACCACCCACTC
TTTGCCGGCCGCGGTCGCCGCGTCCAGGACCCCCAGCATCCGTTTGGCGCTCGGTATGATCCCGTTGGACCGGGC
GATGAGTCGCTTTGGGGTGGCTCATCGGGACGAGCGTTTGGGCCCAGAGGGCAGGGTCCATTTGGACGAGGAGGC
GATCCTTTTGGTGGCGGTGCACCCTTTGGCGGCGGTGGTGGCGGCATCATTTAG
Transcript >OphauG2|50
ATGCCTTCACTTCCAGCCGCCGGGGCCGTGCTGCAAGCCATGGCCGCCGCCCTGCCCACCCATCCTCCCACCGAC
GACTCGTCCGACCTGGCCAGCTCCTACGAGGCTGTTGCTCTGCTTCTTCACGCTTACCTCACTGCCCGGGGCTTT
GTGCTCGTCAGCCTTGACCAAGACAAGCTCAACGAAGAATGCACCTCTCTCGCCCCTCGCCTCCCCTCGTCATGG
AACTCGAGCTTTGGAGCCTATACCCTCGTCTACATTCTCCCTCCCTCCACCCGCCGCCTCGTCATTCTCGTCAAC
CGCATCGCCTCTCGCGTCGAGGTGCGCGCTCTGGTTCACGGCCTCGACCGCATTTCTCGCCTTGAAAGCGCTGTG
CGCGACATTGTCGCTACAAACGGCCTGCCTGTGCGCATACCCATCACCAACGGCCAAGAAGACAGAGGAGACGCC
TTGGTTGACAGACTGCGCCGCATCTTTACCTCTGAGGCGGTGCTTACATCCTTCTTACAAAGCCTCGACGAAGCC
ATTGTACAACCCATCCTCCCACAGCTCACCGGACAAGACGCAGACTCGTCCCAAGGCGACGCCACAGCCCGCGCC
GAGCGTCTCGCCTCTGAAGCCTCTCATCTCAACCTTGCTCCCCGCTCCACCATTCCCCCTCCCAGCACAGCAGAC
CATCTTCCTCCTCCCGCCCGTCCCACCGCAGACTTTGCTCCTCCCGACTTTGAGGACGAACACCAAATGCTTCCG
CGGCCCACTACTTTGCCCGACGGCACCTCCCCATTTAACATTGGCGCAGACGACTTGTACCCTCCAGGCCTCGGC
CCTCACGACCCTCTGCGCCCTGGCTTTACGCCCGGCCCCTCACAAGGCATGCATCCATCCTTTGACCACCCACTC
TTTGCCGGCCGCGGTCGCCGCGTCCAGGACCCCCAGCATCCGTTTGGCGCTCGGTATGATCCCGTTGGACCGGGC
GATGAGTCGCTTTGGGGTGGCTCATCGGGACGAGCGTTTGGGCCCAGAGGGCAGGGTCCATTTGGACGAGGAGGC
GATCCTTTTGGTGGCGGTGCACCCTTTGGCGGCGGTGGTGGCGGCATCATTTAG
Gene >OphauG2|50
ATGCCTTCACTTCCAGCCGCCGGGGCCGTGCTGCAAGCCATGGCCGCCGCCCTGCCCACCCATCCTCCCACCGAC
GACTCGTCCGACCTGGCCAGCTCCTACGAGGCTGTTGCTCTGCTTCTTCACGCTTACCTCACTGCCCGGGGCTTT
GTGCTCGTCAGCCTTGACCAAGACAAGCTCAACGGTACGCCCCCTTCTATGCTCCGTCTTCTTCTTCTTCCTCTG
CCATGCCTCTCTGCTGCTGCTCCCTTCTACCTTGACCAAAAAAAAAAAAAGCTAATACCACGCAGAAGAATGCAC
CTCTCTCGCCCCTCGCCTCCCCTCGTCATGGAACTCGAGCTTTGGAGCCTATACCCTCGTCTACATTCTCCCTCC
CTCCACCCGCCGCCTCGTCATTCTCGTCAACCGCATCGCCTCTCGCGTCGAGGTGCGCGCTCTGGTTCACGGCCT
CGACCGCATTTCTCGCCTTGAAAGCGCTGTGCGCGACATTGTCGCTACAAACGGCCTGCCTGTGCGCATACCCAT
CACCAACGGCCAAGAAGACAGAGGAGACGCCTTGGTTGACAGACTGCGCCGCATCTTTACCTCTGAGGCGGTGCT
TACATGTAAGTCTAGCCGCTTTTCATCCATGTTACTCTTACTCTTGCTACGCCCAAGATAAAAGTGTTCCTCTCA
CAAAGACCATGGCTCGAGCTAACATTGCCCCCAGCCTTCTTACAAAGCCTCGACGAAGCCATTGTACAACCCATC
CTCCCACAGCTCACCGGACAAGACGCAGACTCGTCCCAAGGCGACGCCACAGCCCGCGCCGAGCGTCTCGCCTCT
GAAGCCTCTCATCTCAACCTTGCTCCCCGCTCCACCATTCCCCCTCCCAGCACAGCAGACCATCTTCCTCCTCCC
GCCCGTCCCACCGCAGACTTTGCTCCTCCCGACTTTGAGGACGAACACCAAATGCTTCCGCGGCCCACTACTTTG
CCCGACGGCACCTCCCCATTTAACATTGGCGCAGACGACTTGTACCCTCCAGGCCTCGGCCCTCACGACCCTCTG
CGCCCTGGCTTTACGCCCGGCCCCTCACAAGGCATGCATCCATCCTTTGACCACCCACTCTTTGCCGGCCGCGGT
CGCCGCGTCCAGGACCCCCAGCATCCGTTTGGCGCTCGGTATGATCCCGTTGGACCGGGCGATGAGTCGCTTTGG
GGTGGCTCATCGGGACGAGCGTTTGGGCCCAGAGGGCAGGGTCCATTTGGACGAGGAGGCGATCCTTTTGGTGGC
GGTGCACCCTTTGGCGGCGGTGGTGGCGGCATCATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail