Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5
Gene name
LocationContig_1:8547..9786
Strand+
Gene length (bp)1239
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 1.5E-26 106 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5UP73|YR614_MIMIV Putative band 7 family protein R614 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R614 PE=3 SV=1 50 331 3.0E-57
sp|O28852|Y1420_ARCFU Uncharacterized protein AF_1420 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1420 PE=3 SV=1 113 316 4.0E-34
sp|Q8TAV4|STML3_HUMAN Stomatin-like protein 3 OS=Homo sapiens GN=STOML3 PE=2 SV=1 69 318 4.0E-33
sp|Q6PE84|STML3_MOUSE Stomatin-like protein 3 OS=Mus musculus GN=Stoml3 PE=1 SV=2 93 318 6.0E-33
sp|P27105|STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 73 318 5.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5UP73|YR614_MIMIV Putative band 7 family protein R614 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R614 PE=3 SV=1 50 331 3.0E-57
sp|O28852|Y1420_ARCFU Uncharacterized protein AF_1420 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1420 PE=3 SV=1 113 316 4.0E-34
sp|Q8TAV4|STML3_HUMAN Stomatin-like protein 3 OS=Homo sapiens GN=STOML3 PE=2 SV=1 69 318 4.0E-33
sp|Q6PE84|STML3_MOUSE Stomatin-like protein 3 OS=Mus musculus GN=Stoml3 PE=1 SV=2 93 318 6.0E-33
sp|P27105|STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 73 318 5.0E-31
sp|P54116|STOM_MOUSE Erythrocyte band 7 integral membrane protein OS=Mus musculus GN=Stom PE=1 SV=3 93 318 8.0E-30
sp|Q19958|STO2_CAEEL Stomatin-2 OS=Caenorhabditis elegans GN=sto-2 PE=3 SV=4 75 316 2.0E-28
sp|O59180|PSTOM_PYRHO Stomatin homolog PH1511 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1511 PE=1 SV=1 113 339 1.0E-27
sp|Q9V0Y1|PSTOM_PYRAB Stomatin homolog PYRAB06580 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06580 PE=3 SV=1 105 332 2.0E-27
sp|Q21190|UNC1_CAEEL Protein unc-1 OS=Caenorhabditis elegans GN=unc-1 PE=3 SV=2 77 316 7.0E-27
sp|Q27433|MEC2_CAEEL Mechanosensory protein 2 OS=Caenorhabditis elegans GN=mec-2 PE=1 SV=1 75 316 1.0E-26
sp|Q8K4G9|PODO_RAT Podocin OS=Rattus norvegicus GN=Nphs2 PE=1 SV=2 97 324 2.0E-26
sp|Q16TM5|BND7A_AEDAE Band 7 protein AAEL010189 OS=Aedes aegypti GN=AAEL010189 PE=3 SV=1 69 318 2.0E-26
sp|Q7PPU9|BND7A_ANOGA Band 7 protein AGAP004871 OS=Anopheles gambiae GN=AGAP004871 PE=3 SV=3 98 318 1.0E-25
sp|Q22165|STO4_CAEEL Stomatin-4 OS=Caenorhabditis elegans GN=sto-4 PE=3 SV=2 75 333 1.0E-25
sp|Q19200|STO1_CAEEL Stomatin-1 OS=Caenorhabditis elegans GN=sto-1 PE=3 SV=2 93 316 1.0E-25
sp|Q9VZA4|BND7A_DROME Band 7 protein CG42540 OS=Drosophila melanogaster GN=CG42540 PE=2 SV=2 98 316 2.0E-25
sp|Q91X05|PODO_MOUSE Podocin OS=Mus musculus GN=Nphs2 PE=1 SV=2 97 316 3.0E-25
sp|Q20657|STO3_CAEEL Stomatin-3 OS=Caenorhabditis elegans GN=sto-3 PE=3 SV=1 114 315 1.0E-23
sp|Q9NP85|PODO_HUMAN Podocin OS=Homo sapiens GN=NPHS2 PE=1 SV=1 76 330 3.0E-23
sp|Q58237|Y827_METJA Uncharacterized protein MJ0827 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0827 PE=3 SV=1 107 275 6.0E-23
sp|O26788|Y692_METTH Uncharacterized protein MTH_692 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_692 PE=3 SV=1 103 298 8.0E-23
sp|Q9UJZ1|STML2_HUMAN Stomatin-like protein 2, mitochondrial OS=Homo sapiens GN=STOML2 PE=1 SV=1 107 279 2.0E-21
sp|Q32LL2|STML2_BOVIN Stomatin-like protein 2, mitochondrial OS=Bos taurus GN=STOML2 PE=2 SV=1 107 279 3.0E-21
sp|Q99JB2|STML2_MOUSE Stomatin-like protein 2, mitochondrial OS=Mus musculus GN=Stoml2 PE=1 SV=1 107 279 5.0E-21
sp|Q4FZT0|STML2_RAT Stomatin-like protein 2, mitochondrial OS=Rattus norvegicus GN=Stoml2 PE=1 SV=1 107 279 6.0E-21
sp|P0AA56|QMCA_SHIFL Protein QmcA OS=Shigella flexneri GN=qmcA PE=3 SV=1 105 332 1.0E-20
sp|P0AA53|QMCA_ECOLI Protein QmcA OS=Escherichia coli (strain K12) GN=qmcA PE=1 SV=1 105 332 1.0E-20
sp|P0AA54|QMCA_ECOL6 Protein QmcA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=qmcA PE=3 SV=1 105 332 1.0E-20
sp|P0AA55|QMCA_ECO57 Protein QmcA OS=Escherichia coli O157:H7 GN=qmcA PE=3 SV=1 105 332 1.0E-20
sp|P0DKS0|QMCA_WIGBR Protein QmcA OS=Wigglesworthia glossinidia brevipalpis GN=qmcA PE=3 SV=1 107 302 8.0E-18
sp|O60121|YH77_SCHPO Uncharacterized protein C16G5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.07c PE=3 SV=1 105 286 2.0E-16
sp|P63694|Y1524_MYCBO Uncharacterized protein Mb1524 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1524 PE=3 SV=1 107 302 6.0E-16
sp|P9WPR8|Y1488_MYCTO Uncharacterized protein MT1533.2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1533.2 PE=3 SV=1 107 302 6.0E-16
sp|P9WPR9|Y1488_MYCTU Uncharacterized protein Rv1488 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1488 PE=1 SV=1 107 302 6.0E-16
sp|P72655|Y1128_SYNY3 Uncharacterized protein slr1128 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1128 PE=3 SV=1 105 310 4.0E-13
sp|Q9FHM7|HIR4_ARATH Hypersensitive-induced response protein 4 OS=Arabidopsis thaliana GN=HIR4 PE=1 SV=1 107 318 7.0E-10
sp|Q9KV09|HFLK_VIBCH Protein HflK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hflK PE=3 SV=1 88 247 3.0E-08
sp|P44546|HFLK_HAEIN Protein HflK OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hflK PE=3 SV=1 84 235 4.0E-07
sp|Q9FM19|HIR1_ARATH Hypersensitive-induced response protein 1 OS=Arabidopsis thaliana GN=HIR1 PE=1 SV=1 91 344 1.0E-06
sp|Q8CI66|STML1_MOUSE Stomatin-like protein 1 OS=Mus musculus GN=Stoml1 PE=2 SV=1 114 259 2.0E-06
sp|O83151|HFLK_TREPA Protein HflK OS=Treponema pallidum (strain Nichols) GN=hflK PE=3 SV=1 76 268 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5
MTTASTTSSTEPIITMSGFNGQGSSSSKPPRHLAPTEGSHGGFQPQANMAVIPPRQEDLQRSYATLVGDDANPRG
WYGSMINALGSCLGTVGAVPCCICFPNPYKKVHQGYVGLVTKFGRFYKAVDPGLVKINPLSEELIRIDVKIQMAE
VPEQFCMTKDNVTLRLTSVIYYHIVAPHKAAFGISDIRQALMERTQTTLRHVVGARVLQDVVERREEIAQSIGEI
IEDVAAGWGVQVESMLIKDIVFSQDLQESLSMAAQSKRIGESKIIAAKAEVESAKLMRQAADILSSAPAMQIRYL
EAMQAMAKSANSKVIFLPGASQNLSNALNAVAASQKPGEASGASDEHGQRLAFGSDDAGFQHAINARVVENI*
Coding >OphauG2|5
ATGACCACGGCTTCCACCACATCATCGACGGAGCCCATTATTACCATGTCCGGCTTCAACGGCCAAGGCTCCTCA
TCTTCCAAGCCCCCCCGCCATTTAGCTCCCACCGAGGGCAGCCATGGTGGCTTCCAGCCTCAGGCAAACATGGCT
GTCATTCCGCCGCGCCAGGAAGACTTGCAGCGCAGCTACGCCACTCTAGTGGGCGACGACGCCAACCCAAGGGGC
TGGTACGGCAGCATGATCAATGCTCTTGGCTCTTGTCTGGGCACTGTTGGTGCTGTGCCCTGCTGCATCTGTTTT
CCAAATCCATACAAAAAGGTGCATCAGGGCTATGTCGGCCTCGTGACCAAATTTGGCCGCTTTTACAAGGCCGTC
GATCCTGGTCTCGTCAAGATCAACCCTCTGAGCGAGGAGCTCATTCGCATAGATGTCAAGATTCAGATGGCAGAG
GTGCCCGAGCAGTTCTGCATGACCAAGGACAATGTCACTCTCCGTCTCACGTCCGTCATTTACTACCACATTGTT
GCCCCGCACAAGGCGGCATTTGGCATCTCGGATATTCGTCAGGCCCTCATGGAACGCACACAGACTACCTTGCGC
CACGTGGTCGGTGCTCGTGTACTGCAAGATGTCGTGGAGCGCCGCGAGGAAATCGCCCAGTCGATTGGCGAGATC
ATTGAGGACGTGGCTGCTGGATGGGGAGTCCAGGTTGAGAGTATGCTCATCAAGGATATCGTCTTTAGCCAGGAT
CTTCAGGAGTCGCTCTCCATGGCTGCCCAGAGTAAGCGCATCGGCGAAAGCAAGATTATTGCCGCCAAGGCAGAG
GTCGAGTCTGCAAAGCTGATGCGCCAGGCTGCCGATATCCTCAGTTCGGCACCTGCCATGCAGATTCGCTACCTA
GAGGCCATGCAAGCCATGGCCAAGTCTGCAAATAGCAAGGTCATATTTTTGCCCGGCGCCAGCCAGAATCTTAGC
AATGCCCTCAACGCCGTTGCTGCATCGCAAAAGCCTGGTGAGGCAAGCGGCGCCTCCGACGAGCATGGCCAACGA
CTCGCTTTTGGAAGTGATGACGCTGGCTTCCAGCATGCCATCAACGCTCGTGTCGTCGAGAACATCTAG
Transcript >OphauG2|5
ATGACCACGGCTTCCACCACATCATCGACGGAGCCCATTATTACCATGTCCGGCTTCAACGGCCAAGGCTCCTCA
TCTTCCAAGCCCCCCCGCCATTTAGCTCCCACCGAGGGCAGCCATGGTGGCTTCCAGCCTCAGGCAAACATGGCT
GTCATTCCGCCGCGCCAGGAAGACTTGCAGCGCAGCTACGCCACTCTAGTGGGCGACGACGCCAACCCAAGGGGC
TGGTACGGCAGCATGATCAATGCTCTTGGCTCTTGTCTGGGCACTGTTGGTGCTGTGCCCTGCTGCATCTGTTTT
CCAAATCCATACAAAAAGGTGCATCAGGGCTATGTCGGCCTCGTGACCAAATTTGGCCGCTTTTACAAGGCCGTC
GATCCTGGTCTCGTCAAGATCAACCCTCTGAGCGAGGAGCTCATTCGCATAGATGTCAAGATTCAGATGGCAGAG
GTGCCCGAGCAGTTCTGCATGACCAAGGACAATGTCACTCTCCGTCTCACGTCCGTCATTTACTACCACATTGTT
GCCCCGCACAAGGCGGCATTTGGCATCTCGGATATTCGTCAGGCCCTCATGGAACGCACACAGACTACCTTGCGC
CACGTGGTCGGTGCTCGTGTACTGCAAGATGTCGTGGAGCGCCGCGAGGAAATCGCCCAGTCGATTGGCGAGATC
ATTGAGGACGTGGCTGCTGGATGGGGAGTCCAGGTTGAGAGTATGCTCATCAAGGATATCGTCTTTAGCCAGGAT
CTTCAGGAGTCGCTCTCCATGGCTGCCCAGAGTAAGCGCATCGGCGAAAGCAAGATTATTGCCGCCAAGGCAGAG
GTCGAGTCTGCAAAGCTGATGCGCCAGGCTGCCGATATCCTCAGTTCGGCACCTGCCATGCAGATTCGCTACCTA
GAGGCCATGCAAGCCATGGCCAAGTCTGCAAATAGCAAGGTCATATTTTTGCCCGGCGCCAGCCAGAATCTTAGC
AATGCCCTCAACGCCGTTGCTGCATCGCAAAAGCCTGGTGAGGCAAGCGGCGCCTCCGACGAGCATGGCCAACGA
CTCGCTTTTGGAAGTGATGACGCTGGCTTCCAGCATGCCATCAACGCTCGTGTCGTCGAGAACATCTAG
Gene >OphauG2|5
ATGACCACGGCTTCCACCACATCATCGACGGAGCCCATTATTACCATGTCCGGCTTCAACGGCCAAGGCTCCTCA
TCTTCCAAGCCCCCCCGCCATTTAGCTCCCACCGAGGGCAGCCATGGTGGCTTCCAGCCTCAGGCAAACATGGCT
GTCATTCCGCCGCGCCAGGAAGACTTGCAGCGCAGCTACGCCACTCTAGTGGGCGACGACGCCAACCCAAGGGGC
TGGTACGGCAGCATGAGTATGCTCAAGGCTGCATCCTCGATTTTCTTTCCGCCCTGACACTGTATCGCAGTCAAT
GCTCTTGGCTCTTGTCTGGGCACTGTTGGTGCTGTGCCCTGCTGCATCTGTTTTCCAAATCCATACAAAAAGGTG
CATCAGGGCTATGTCGGCCTCGTGACCAAATTTGGCCGCTTTTACAAGGCCGTCGATCCTGGTCTCGTCAAGATC
AACCCTCTGAGCGAGGAGCTCATTCGCATAGATGTCAAGATTCAGATGGCAGAGGTGCCCGAGCAGTTCTGCATG
ACCAAGGACAATGTCACTCTCCGTCTCACGTCCGTCATTTACTACCACATTGTTGCCCCGCACAAGGCGGCATTT
GGCATCTCGGATATTCGTCAGGCCCTCATGGAACGCACACAGACTACCTTGCGCCACGTGGTCGGTGCTCGTGTA
CTGCAAGATGTCGTGGAGCGCCGCGAGGAAATCGCCCAGTCGATTGGCGAGATCATTGAGGACGTGGCTGCTGGA
TGGGGAGTCCAGGTTGAGAGTATGCTCATCAAGGATATCGTCTTTAGCCAGGATCTTCAGGAGTCGCTCTCCATG
GCTGCCCAGAGTAAGCGCATCGGCGAAAGCAAGATTATTGCCGCCAAGGCAGAGGTTTGTCACTTTCCAACCCCG
TGCCTTTTTTTCTCTCGTTTCTAATGCTAATCTTCCCCTCCCCAGGTCGAGTCTGCAAAGCTGATGCGCCAGGCT
GCCGATATCCTCAGTTCGGCACCTGCCATGCAGATTCGCTACCTAGAGGCCATGCAAGCCATGGCCAAGTCTGCA
AATAGCAAGGTCATATTTTTGCCCGGCGCCAGCCAGAATCTTAGCAATGCCCTCAACGCCGTTGCTGCATCGCAA
AAGCCTGGTGAGGCAAGCGGCGCCTCCGACGAGCATGGCCAACGACTCGCTTTTGGAAGTGATGACGCTGGCTTC
CAGCATGCCATCAACGCTCGTGTCGTCGAGAACATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail