Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4980
Gene name
LocationContig_438:6670..10517
Strand+
Gene length (bp)3847
Transcript length (bp)3732
Coding sequence length (bp)3732
Protein length (aa) 1244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 2.7E-72 912 1190
PF15405 PH_5 Pleckstrin homology domain 2.0E-44 754 878
PF00621 RhoGEF RhoGEF domain 4.0E-29 530 716
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 2.8E-15 363 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 434 1199 0.0E+00
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 300 1210 0.0E+00
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 442 1213 7.0E-171
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 322 1212 5.0E-140
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 452 1170 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 434 1199 0.0E+00
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 300 1210 0.0E+00
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 442 1213 7.0E-171
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 322 1212 5.0E-140
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 452 1170 1.0E-39
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 322 429 1.0E-29
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 295 431 5.0E-27
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 504 885 7.0E-23
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 504 874 1.0E-22
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 504 874 1.0E-22
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 504 874 3.0E-22
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 504 881 2.0E-21
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 507 874 3.0E-20
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 507 874 2.0E-19
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 517 796 6.0E-16
sp|Q553D3|GXCJJ_DICDI Rac guanine nucleotide exchange factor JJ OS=Dictyostelium discoideum GN=gxcJJ PE=1 SV=1 518 783 2.0E-13
sp|Q5VV41|ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens GN=ARHGEF16 PE=1 SV=1 516 904 4.0E-13
sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 488 785 7.0E-13
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 516 784 8.0E-13
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 484 754 1.0E-12
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 503 784 5.0E-12
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 521 794 8.0E-12
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 526 741 2.0E-11
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 484 754 2.0E-11
sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 517 872 5.0E-11
sp|Q3U5C8|ARHGG_MOUSE Rho guanine nucleotide exchange factor 16 OS=Mus musculus GN=Arhgef16 PE=1 SV=3 516 871 9.0E-11
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 524 780 3.0E-10
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 524 780 3.0E-10
sp|Q92888|ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens GN=ARHGEF1 PE=1 SV=2 508 716 3.0E-10
sp|O94989|ARHGF_HUMAN Rho guanine nucleotide exchange factor 15 OS=Homo sapiens GN=ARHGEF15 PE=1 SV=4 516 762 6.0E-10
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 524 896 1.0E-09
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 521 794 3.0E-09
sp|Q9Z1I6|ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus GN=Arhgef1 PE=2 SV=1 508 691 3.0E-09
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 526 740 7.0E-09
sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus GN=Arhgef12 PE=1 SV=2 486 749 7.0E-09
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 508 691 8.0E-09
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 530 786 1.0E-08
sp|Q9NXL2|ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens GN=ARHGEF38 PE=2 SV=2 526 763 1.0E-08
sp|Q66T02|PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus GN=Plekhg5 PE=1 SV=1 514 882 1.0E-08
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 530 786 1.0E-08
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 518 721 3.0E-08
sp|Q60992|VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus GN=Vav2 PE=1 SV=1 472 882 4.0E-08
sp|Q3KR16|PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens GN=PLEKHG6 PE=1 SV=3 505 810 4.0E-08
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 859 1227 5.0E-08
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 859 1227 6.0E-08
sp|Q5FWH6|ARHGF_MOUSE Rho guanine nucleotide exchange factor 15 OS=Mus musculus GN=Arhgef15 PE=1 SV=1 516 762 7.0E-08
sp|P11433|CDC24_YEAST Cell division control protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC24 PE=1 SV=2 521 790 7.0E-08
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 523 798 7.0E-08
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 859 1227 1.0E-07
sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=1 SV=2 523 882 2.0E-07
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 518 688 2.0E-07
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 476 773 2.0E-07
sp|Q8R0J1|PKHG6_MOUSE Pleckstrin homology domain-containing family G member 6 OS=Mus musculus GN=Plekhg6 PE=2 SV=2 527 810 2.0E-07
sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 523 780 2.0E-07
sp|O94827|PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens GN=PLEKHG5 PE=1 SV=3 514 882 2.0E-07
sp|Q6RFZ7|PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus GN=Plekhg5 PE=1 SV=1 514 810 3.0E-07
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 518 721 3.0E-07
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 520 723 3.0E-07
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 502 723 3.0E-07
sp|P52735|VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens GN=VAV2 PE=1 SV=2 524 882 3.0E-07
sp|Q6TXD4|DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus GN=Dnmbp PE=1 SV=2 525 764 7.0E-07
sp|Q15052|ARHG6_HUMAN Rho guanine nucleotide exchange factor 6 OS=Homo sapiens GN=ARHGEF6 PE=1 SV=2 530 875 9.0E-07
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 476 758 2.0E-06
sp|Q9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens GN=ARHGEF12 PE=1 SV=1 486 749 3.0E-06
sp|Q12802|AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens GN=AKAP13 PE=1 SV=2 526 886 3.0E-06
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 525 763 3.0E-06
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 518 724 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0003674 molecular_function No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0050789 regulation of biological process No
GO:0030234 enzyme regulator activity No
GO:0007165 signal transduction No
GO:0098772 molecular function regulator activity No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0030695 GTPase regulator activity No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4980
MADYQYDPRAAAQRQRGYHDTSNNQRDAAFSNIFGAAPPPGRSQTMTSQPQHSSTRDHGRTQTMSSVASGSSRPP
PPRPPQGYSAEREAMDARGRQPEQSGYYVAQRSASGGQALPPQGHHAQHQAFQQQQQAARRPYAAPGAGPAPPRL
DARGAPAQAAGARYQPQRSYHGAPGPALNSDPYRSQSLASMPRPQMYNPPPSSYQQSPASGFRHAQYSHQPSART
TAQGRIVPERHDDRTMSMTGGFPQDRDLRQTMSGRIIPNKHASPEVPMPKVPQHAVYAGQNARAIAERTRTMSMA
SSVALSMAAADAEGHIIGQRPSRSTSMESQYPPVATKIRPPVVYPAMLSMVADCFRRKIVPGDRTKNELTYKNAF
SGSEAVDVLSYILRTTDRNLALLLGRALDAQKFFHDVTYEHRLRDSQSEMYQFRESLMEEPEEKSPVNGVFVLLS
ECYSPTCTRDQLCYSIACPRRLEQVSRLNLKTGPGLRKEDSAAVNDDEAYQTDEQKLWINSVPKEIADAVSEREK
RRQEIISEICYTERDFVKDLEYLRDFWIVPLRSKASPIPVPRREKVVKGIFGNIIDHPSIHNVSARFAAGLTARQ
QKEPVVHHIGDVFLENVPYFEPFLVYGARQMEGKYEYENEKACNPYFARFSDEIERRKESRKLELNGYLTKPTTR
LARYPLLLEAALRNTEGDDNPDKEDIPKVLVMIRDLLGRLNVETGKAENRHTLRRLHEQLKFRPNERVDLKLTEE
GRELIFKSQLKKSATDVAEVTVYLFDHAVLLVRVKVNGKTEEIKAYRRPIPLELLAIKEMDEVIPAQGVKRSSSS
LIPGIRNNDSGTKKGEGYPITFRHLGKAGYEQTLYATNQAARQKWLEHIDNTQQRLRSRADFFNTTVISSNFFVG
TNQVRCVTPFDGGRKLLYGTDSGIYVSDRKNKEQAPRRVLESTNVTQIDILEEYQLLLVLSNKTLQSYPLSALNP
EEGAPARRPKKIQNHCSFFKTGICLGRHLVCCVKSSALSTTIKVFEPNDAMTKAKKQKGLGKLMAGGQDELKPFK
EFYIPTESSSVHFLKSKLCVACARGFEVVSLETLETQSLLDQADTSLDFVARKENVKPIHIERLNGEFLLNYTEF
SFFVNRNGWRARPEWRIDWEGTPQSFALSYPWILAFETNFIELRNIENGAVHIVPHKNIRMLHSSTHEILFAYED
ERGEDVVEAIDFWKNKRRSELLAPTASTAASALPAGGSPSSQR*
Coding >OphauG2|4980
ATGGCCGACTACCAGTATGACCCTCGAGCAGCTGCCCAGCGTCAGCGCGGCTATCACGATACGAGCAACAACCAG
CGAGATGCCGCCTTTTCTAATATTTTTGGCGCTGCTCCGCCTCCTGGACGATCTCAGACCATGACGTCGCAGCCC
CAGCATAGTTCTACAAGAGACCACGGCAGGACGCAAACCATGTCGTCGGTGGCCTCTGGCTCAAGCCGACCCCCG
CCTCCACGCCCACCACAAGGATACTCTGCTGAGCGCGAGGCCATGGATGCCCGAGGTCGCCAGCCCGAACAGAGC
GGCTACTATGTTGCCCAGCGATCTGCATCTGGCGGACAAGCGCTGCCGCCCCAAGGCCATCATGCGCAACATCAA
GCTTTCCAGCAGCAGCAACAGGCTGCTCGGAGGCCATATGCTGCTCCTGGCGCTGGTCCTGCCCCCCCGCGACTC
GATGCCCGAGGAGCCCCTGCTCAGGCTGCTGGTGCTAGGTACCAGCCGCAGAGGTCGTATCATGGGGCCCCGGGC
CCTGCCCTCAACAGCGACCCGTATCGCTCTCAATCTCTGGCATCGATGCCGCGCCCCCAAATGTATAACCCTCCG
CCTAGCTCCTACCAGCAGTCGCCTGCCAGTGGCTTTCGCCATGCCCAATACAGCCATCAGCCCTCGGCAAGGACC
ACAGCGCAGGGCAGAATTGTCCCTGAACGACATGACGACCGCACCATGTCCATGACTGGGGGTTTTCCTCAGGAT
AGAGATCTCCGCCAGACAATGAGTGGCCGCATCATCCCCAACAAGCATGCTTCGCCCGAGGTGCCCATGCCAAAG
GTGCCTCAGCACGCAGTATATGCAGGACAAAATGCGCGCGCCATTGCAGAACGCACGCGCACCATGTCCATGGCG
TCGAGTGTTGCCTTATCCATGGCGGCGGCTGATGCTGAAGGCCATATAATAGGCCAGCGGCCTTCGCGGAGTACG
TCGATGGAGAGCCAATACCCACCGGTGGCGACAAAGATTAGGCCCCCTGTTGTCTACCCTGCCATGCTCTCCATG
GTGGCCGACTGTTTTCGCCGAAAGATTGTGCCGGGCGATCGCACCAAGAACGAGCTTACATATAAGAATGCCTTT
AGTGGATCCGAAGCCGTCGACGTGCTTTCGTATATTCTTAGGACGACGGATCGCAACTTGGCGCTGCTGCTCGGC
CGAGCCCTCGATGCACAAAAGTTCTTCCACGACGTGACTTATGAGCATAGGCTGCGTGACTCGCAGTCGGAAATG
TACCAGTTTAGAGAGAGCTTGATGGAGGAGCCAGAGGAAAAGTCTCCTGTAAACGGTGTTTTTGTTTTGCTCTCG
GAGTGCTACTCGCCGACTTGCACACGAGACCAACTCTGCTACTCAATTGCCTGCCCGCGCCGACTCGAGCAGGTG
TCCAGGTTAAACCTCAAGACAGGCCCGGGCTTGCGCAAAGAGGACTCGGCTGCCGTCAATGACGACGAGGCCTAT
CAGACCGACGAGCAGAAGCTTTGGATCAACTCGGTCCCCAAGGAAATCGCCGATGCGGTCAGCGAGAGGGAGAAG
AGGAGACAGGAAATCATTTCGGAAATATGCTACACCGAGAGAGATTTTGTCAAGGACCTCGAGTATCTGCGTGAC
TTTTGGATCGTACCGCTGCGATCCAAGGCATCCCCCATTCCCGTGCCGCGACGGGAAAAGGTGGTCAAGGGCATC
TTTGGCAATATTATTGACCATCCCAGCATTCACAATGTCAGCGCCCGCTTTGCGGCAGGCCTAACGGCAAGACAG
CAAAAGGAGCCGGTTGTCCATCATATTGGAGATGTCTTCCTCGAAAATGTGCCCTATTTTGAGCCCTTTCTGGTT
TACGGCGCCAGACAGATGGAGGGCAAGTACGAGTACGAGAATGAAAAGGCTTGCAATCCCTACTTTGCCCGATTT
TCCGACGAGATTGAACGCCGCAAAGAATCGCGCAAGCTGGAGCTCAATGGCTATCTTACGAAGCCGACTACTCGC
CTTGCTCGATACCCGTTGCTTCTCGAAGCAGCACTCAGGAACACGGAAGGCGACGACAATCCGGACAAGGAGGAC
ATTCCTAAGGTGCTTGTCATGATTCGCGATTTACTCGGCAGACTAAACGTGGAGACGGGCAAGGCAGAAAATCGG
CACACTTTGCGGCGGCTGCACGAACAGCTCAAGTTTAGGCCCAATGAGAGGGTTGACCTCAAGTTGACGGAAGAA
GGGCGAGAGCTTATATTCAAGAGTCAGCTCAAAAAGTCTGCCACCGACGTGGCCGAGGTGACGGTTTACCTTTTT
GACCACGCCGTTCTTCTCGTGCGCGTCAAGGTTAATGGCAAGACGGAGGAGATCAAGGCGTATCGACGCCCCATA
CCGCTGGAGCTGCTTGCCATCAAGGAAATGGACGAAGTGATTCCGGCCCAGGGAGTCAAGCGGTCATCGTCGAGC
CTGATTCCTGGCATAAGGAACAACGATTCGGGGACCAAGAAGGGCGAAGGGTATCCAATTACCTTTCGGCATTTG
GGCAAGGCGGGATATGAGCAGACACTGTATGCTACTAACCAGGCTGCTCGTCAGAAATGGCTCGAACACATTGAC
AATACGCAGCAGCGGCTACGCAGCCGAGCCGACTTTTTCAATACAACGGTGATATCGAGCAACTTTTTTGTCGGC
ACCAACCAGGTGCGATGCGTGACGCCGTTTGACGGCGGACGCAAGTTGCTATACGGAACCGACAGCGGCATCTAC
GTGTCTGACCGCAAGAACAAGGAGCAGGCGCCGCGCAGGGTGTTGGAGAGCACCAATGTGACGCAGATTGACATT
TTGGAAGAGTACCAGCTCCTGCTGGTGCTGAGCAACAAGACGCTGCAGTCGTACCCCCTGTCAGCATTGAATCCC
GAAGAGGGCGCGCCGGCAAGAAGACCCAAGAAGATTCAAAACCACTGCAGCTTCTTCAAGACGGGAATATGCTTG
GGGCGGCACTTGGTGTGCTGCGTCAAATCATCTGCGCTGTCGACAACCATCAAGGTGTTTGAGCCCAATGACGCC
ATGACCAAGGCCAAGAAGCAGAAGGGGCTAGGCAAGCTCATGGCCGGGGGCCAGGACGAGCTCAAGCCATTCAAG
GAGTTTTACATTCCGACCGAGTCATCGTCGGTGCATTTTCTTAAGTCGAAGCTCTGCGTGGCTTGTGCTCGTGGC
TTCGAGGTGGTGTCGCTCGAGACGCTCGAGACGCAGTCTCTACTGGACCAGGCCGACACGTCGCTCGACTTTGTT
GCACGCAAGGAAAACGTCAAGCCGATACACATAGAGCGCCTCAATGGCGAATTTTTGCTCAACTATACCGAGTTT
TCCTTTTTTGTTAACCGTAACGGCTGGCGAGCGCGACCCGAGTGGCGCATAGACTGGGAGGGAACGCCACAGAGC
TTCGCGCTGAGCTATCCCTGGATTCTGGCGTTTGAGACCAACTTTATCGAGCTGCGCAACATTGAGAATGGCGCC
GTGCATATCGTGCCTCACAAGAACATTCGCATGCTGCACAGCAGCACCCACGAGATATTGTTTGCTTACGAGGAT
GAGCGAGGCGAGGATGTGGTTGAAGCAATTGACTTTTGGAAGAATAAGCGTCGATCCGAGTTGCTGGCGCCGACT
GCATCCACGGCGGCATCTGCGCTCCCGGCCGGTGGCTCGCCATCAAGCCAGCGGTAG
Transcript >OphauG2|4980
ATGGCCGACTACCAGTATGACCCTCGAGCAGCTGCCCAGCGTCAGCGCGGCTATCACGATACGAGCAACAACCAG
CGAGATGCCGCCTTTTCTAATATTTTTGGCGCTGCTCCGCCTCCTGGACGATCTCAGACCATGACGTCGCAGCCC
CAGCATAGTTCTACAAGAGACCACGGCAGGACGCAAACCATGTCGTCGGTGGCCTCTGGCTCAAGCCGACCCCCG
CCTCCACGCCCACCACAAGGATACTCTGCTGAGCGCGAGGCCATGGATGCCCGAGGTCGCCAGCCCGAACAGAGC
GGCTACTATGTTGCCCAGCGATCTGCATCTGGCGGACAAGCGCTGCCGCCCCAAGGCCATCATGCGCAACATCAA
GCTTTCCAGCAGCAGCAACAGGCTGCTCGGAGGCCATATGCTGCTCCTGGCGCTGGTCCTGCCCCCCCGCGACTC
GATGCCCGAGGAGCCCCTGCTCAGGCTGCTGGTGCTAGGTACCAGCCGCAGAGGTCGTATCATGGGGCCCCGGGC
CCTGCCCTCAACAGCGACCCGTATCGCTCTCAATCTCTGGCATCGATGCCGCGCCCCCAAATGTATAACCCTCCG
CCTAGCTCCTACCAGCAGTCGCCTGCCAGTGGCTTTCGCCATGCCCAATACAGCCATCAGCCCTCGGCAAGGACC
ACAGCGCAGGGCAGAATTGTCCCTGAACGACATGACGACCGCACCATGTCCATGACTGGGGGTTTTCCTCAGGAT
AGAGATCTCCGCCAGACAATGAGTGGCCGCATCATCCCCAACAAGCATGCTTCGCCCGAGGTGCCCATGCCAAAG
GTGCCTCAGCACGCAGTATATGCAGGACAAAATGCGCGCGCCATTGCAGAACGCACGCGCACCATGTCCATGGCG
TCGAGTGTTGCCTTATCCATGGCGGCGGCTGATGCTGAAGGCCATATAATAGGCCAGCGGCCTTCGCGGAGTACG
TCGATGGAGAGCCAATACCCACCGGTGGCGACAAAGATTAGGCCCCCTGTTGTCTACCCTGCCATGCTCTCCATG
GTGGCCGACTGTTTTCGCCGAAAGATTGTGCCGGGCGATCGCACCAAGAACGAGCTTACATATAAGAATGCCTTT
AGTGGATCCGAAGCCGTCGACGTGCTTTCGTATATTCTTAGGACGACGGATCGCAACTTGGCGCTGCTGCTCGGC
CGAGCCCTCGATGCACAAAAGTTCTTCCACGACGTGACTTATGAGCATAGGCTGCGTGACTCGCAGTCGGAAATG
TACCAGTTTAGAGAGAGCTTGATGGAGGAGCCAGAGGAAAAGTCTCCTGTAAACGGTGTTTTTGTTTTGCTCTCG
GAGTGCTACTCGCCGACTTGCACACGAGACCAACTCTGCTACTCAATTGCCTGCCCGCGCCGACTCGAGCAGGTG
TCCAGGTTAAACCTCAAGACAGGCCCGGGCTTGCGCAAAGAGGACTCGGCTGCCGTCAATGACGACGAGGCCTAT
CAGACCGACGAGCAGAAGCTTTGGATCAACTCGGTCCCCAAGGAAATCGCCGATGCGGTCAGCGAGAGGGAGAAG
AGGAGACAGGAAATCATTTCGGAAATATGCTACACCGAGAGAGATTTTGTCAAGGACCTCGAGTATCTGCGTGAC
TTTTGGATCGTACCGCTGCGATCCAAGGCATCCCCCATTCCCGTGCCGCGACGGGAAAAGGTGGTCAAGGGCATC
TTTGGCAATATTATTGACCATCCCAGCATTCACAATGTCAGCGCCCGCTTTGCGGCAGGCCTAACGGCAAGACAG
CAAAAGGAGCCGGTTGTCCATCATATTGGAGATGTCTTCCTCGAAAATGTGCCCTATTTTGAGCCCTTTCTGGTT
TACGGCGCCAGACAGATGGAGGGCAAGTACGAGTACGAGAATGAAAAGGCTTGCAATCCCTACTTTGCCCGATTT
TCCGACGAGATTGAACGCCGCAAAGAATCGCGCAAGCTGGAGCTCAATGGCTATCTTACGAAGCCGACTACTCGC
CTTGCTCGATACCCGTTGCTTCTCGAAGCAGCACTCAGGAACACGGAAGGCGACGACAATCCGGACAAGGAGGAC
ATTCCTAAGGTGCTTGTCATGATTCGCGATTTACTCGGCAGACTAAACGTGGAGACGGGCAAGGCAGAAAATCGG
CACACTTTGCGGCGGCTGCACGAACAGCTCAAGTTTAGGCCCAATGAGAGGGTTGACCTCAAGTTGACGGAAGAA
GGGCGAGAGCTTATATTCAAGAGTCAGCTCAAAAAGTCTGCCACCGACGTGGCCGAGGTGACGGTTTACCTTTTT
GACCACGCCGTTCTTCTCGTGCGCGTCAAGGTTAATGGCAAGACGGAGGAGATCAAGGCGTATCGACGCCCCATA
CCGCTGGAGCTGCTTGCCATCAAGGAAATGGACGAAGTGATTCCGGCCCAGGGAGTCAAGCGGTCATCGTCGAGC
CTGATTCCTGGCATAAGGAACAACGATTCGGGGACCAAGAAGGGCGAAGGGTATCCAATTACCTTTCGGCATTTG
GGCAAGGCGGGATATGAGCAGACACTGTATGCTACTAACCAGGCTGCTCGTCAGAAATGGCTCGAACACATTGAC
AATACGCAGCAGCGGCTACGCAGCCGAGCCGACTTTTTCAATACAACGGTGATATCGAGCAACTTTTTTGTCGGC
ACCAACCAGGTGCGATGCGTGACGCCGTTTGACGGCGGACGCAAGTTGCTATACGGAACCGACAGCGGCATCTAC
GTGTCTGACCGCAAGAACAAGGAGCAGGCGCCGCGCAGGGTGTTGGAGAGCACCAATGTGACGCAGATTGACATT
TTGGAAGAGTACCAGCTCCTGCTGGTGCTGAGCAACAAGACGCTGCAGTCGTACCCCCTGTCAGCATTGAATCCC
GAAGAGGGCGCGCCGGCAAGAAGACCCAAGAAGATTCAAAACCACTGCAGCTTCTTCAAGACGGGAATATGCTTG
GGGCGGCACTTGGTGTGCTGCGTCAAATCATCTGCGCTGTCGACAACCATCAAGGTGTTTGAGCCCAATGACGCC
ATGACCAAGGCCAAGAAGCAGAAGGGGCTAGGCAAGCTCATGGCCGGGGGCCAGGACGAGCTCAAGCCATTCAAG
GAGTTTTACATTCCGACCGAGTCATCGTCGGTGCATTTTCTTAAGTCGAAGCTCTGCGTGGCTTGTGCTCGTGGC
TTCGAGGTGGTGTCGCTCGAGACGCTCGAGACGCAGTCTCTACTGGACCAGGCCGACACGTCGCTCGACTTTGTT
GCACGCAAGGAAAACGTCAAGCCGATACACATAGAGCGCCTCAATGGCGAATTTTTGCTCAACTATACCGAGTTT
TCCTTTTTTGTTAACCGTAACGGCTGGCGAGCGCGACCCGAGTGGCGCATAGACTGGGAGGGAACGCCACAGAGC
TTCGCGCTGAGCTATCCCTGGATTCTGGCGTTTGAGACCAACTTTATCGAGCTGCGCAACATTGAGAATGGCGCC
GTGCATATCGTGCCTCACAAGAACATTCGCATGCTGCACAGCAGCACCCACGAGATATTGTTTGCTTACGAGGAT
GAGCGAGGCGAGGATGTGGTTGAAGCAATTGACTTTTGGAAGAATAAGCGTCGATCCGAGTTGCTGGCGCCGACT
GCATCCACGGCGGCATCTGCGCTCCCGGCCGGTGGCTCGCCATCAAGCCAGCGGTAG
Gene >OphauG2|4980
ATGGCCGACTACCAGTATGACCCTCGAGCAGCTGCCCAGCGTCAGCGCGGCTATCACGATACGAGCAACAACCAG
CGAGATGCCGCCTTTTCTAATATTTTTGGCGCTGCTCCGCCTCCTGGACGATCTCAGACCATGACGTCGCAGCCC
CAGCATAGTTCTACAAGAGACCACGGCAGGACGCAAACCATGTCGTCGGTGGCCTCTGGCTCAAGCCGACCCCCG
CCTCCACGCCCACCACAAGGATACTCTGCTGAGCGCGAGGCCATGGATGCCCGAGGTCGCCAGCCCGAACAGAGC
GGCTACTATGTTGCCCAGCGATCTGCATCTGGCGGACAAGCGCTGCCGCCCCAAGGCCATCATGCGCAACATCAA
GCTTTCCAGCAGCAGCAACAGGCTGCTCGGAGGCCATATGCTGCTCCTGGCGCTGGTCCTGCCCCCCCGCGACTC
GATGCCCGAGGAGCCCCTGCTCAGGCTGCTGGTGCTAGGTACCAGCCGCAGAGGTCGTATCATGGGGCCCCGGGC
CCTGCCCTCAACAGCGACCCGTATCGCTCTCAATCTCTGGCATCGATGCCGCGCCCCCAAATGTATAACCCTCCG
CCTAGCTCCTACCAGCAGTCGCCTGCCAGTGGCTTTCGCCATGCCCAATACAGCCATCAGCCCTCGGCAAGGACC
ACAGCGCAGGGCAGAATTGTCCCTGAACGACATGACGACCGCACCATGTCCATGACTGGGGGTTTTCCTCAGGAT
AGAGATCTCCGCCAGACAATGAGTGGCCGCATCATCCCCAACAAGCATGCTTCGCCCGAGGTGCCCATGCCAAAG
GTGCCTCAGCACGCAGTATATGCAGGACAAAATGCGCGCGCCATTGCAGAACGCACGCGCACCATGTCCATGGCG
TCGAGTGTTGCCTTATCCATGGCGGCGGCTGATGCTGAAGGCCATATAATAGGCCAGCGGCCTTCGCGGAGTACG
TCGATGGAGAGCCAATACCCACCGGTGGCGACAAAGATTAGGCCCCCTGTTGTCTACCCTGCCATGCTCTCCATG
GTGGCCGACTGTTTTCGCCGAAAGATTGTGCCGGGCGATCGCACCAAGAACGAGCTTACATATAAGAATGCCTTT
AGTGGATCCGAAGCCGTCGACGTGCTTTCGTATATTCTTAGGACGACGGATCGCAACTTGGCGCTGCTGCTCGGC
CGAGCCCTCGATGCACAAAAGTTCTTCCACGACGTGACTTATGAGCATAGGCTGCGTGACTCGCAGTCGGAAATG
TACCAGTTTAGAGAGAGCTTGATGGAGGAGCCAGAGGAAAAGTCTCCTGTAAACGGTGTTTTTGTTTTGCTCTCG
GAGTGCTACTCGCCGACTTGCACACGAGACCAACTCTGCTACTCAATTGCCTGCCCGCGCCGACTCGAGCAGGTG
TCCAGGTTAAACCTCAAGACAGGCCCGGGCTTGCGCAAAGAGGACTCGGCTGCCGTCAATGACGACGAGGCCTAT
CAGACCGACGAGCAGAAGCTTTGGATCAACTCGGTCCCCAAGGAAATCGCCGATGCGGTCAGCGAGAGGGAGAAG
AGGAGACAGGAAATCATTTCGGAAATATGCTACACCGAGAGAGATTTTGTCAAGGACCTCGAGTATCTGCGTGAC
TTTTGGATCGTACCGCTGCGATCCAAGGCATCCCCCATTCCCGTGCCGCGACGGGAAAAGGTGGTCAAGGGCATC
TTTGGCAATATTATTGACCATCCCAGCATTCACAATGTCAGCGCCCGCTTTGCGGCAGGCCTAACGGCAAGACAG
CAAAAGGAGCCGGTTGTCCATCATATTGGAGATGTCTTCCTCGAAAATGTGCCCTATTTTGAGCCCTTTCTGGTT
TACGGCGCCAGACAGATGGAGGGCAAGTACGAGTACGAGAATGAAAAGGCTTGCAATCCCTACTTTGCCCGATTT
TCCGACGAGATTGAACGCCGCAAAGAATCGCGCAAGCTGGAGCTCAATGGCTATCTTACGAAGCCGACTACTCGC
CTTGCTCGATACCCGTTGCTTCTCGAAGCAGCACTCAGGAACACGGAAGGCGACGACAATCCGGACAAGGAGGAC
ATTCCTAAGGTGCTTGTCATGATTCGCGATTTACTCGGCAGACTAAACGTGGAGACGGGCAAGGCAGAAAATCGG
CACACTTTGCGGCGGCTGCACGAACAGCTCAAGTTTAGGCCCAATGAGAGGGTTGACCTCAAGTTGACGGAAGAA
GGGCGAGAGCTTATATTCAAGAGTCAGCTCAAAAAGTCTGCCACCGACGTGGCCGAGGTGACGGTTTACCTTTTT
GACCACGCCGTTCTTCTCGTGCGCGTCAAGGTTAATGGCAAGACGGAGGAGATCAAGGCGTATCGACGCCCCATA
CCGCTGGAGCTGCTTGCCATCAAGGAAATGGACGAAGTGATTCCGGCCCAGGGAGTCAAGCGGTCATCGTCGAGC
CTGATTCCTGGCATAAGGAACAACGATTCGGGGACCAAGAAGGGCGAAGGGTATCCAATTACCTTTCGGCATTTG
GGCAAGGCGGGATATGAGCAGACACTGTATGCTACTAACCAGGCTGCTCGTCAGAAATGGCTCGAACACATTGAC
AATACGCAGCAGCGGCTACGCAGCCGAGCCGACTTTTTCAATACAACGGTGATATCGAGCAACTTTTTTGTCGGC
ACCAACCAGGTGCGATGCGTGACGCCGTTTGGTAAGCTGTGTCTGGTGTCTTTGCAGCATGGACGGGACTGACAG
GGTGCGTTGTGGGCAGACGGCGGACGCAAGTTGCTATACGGAACCGACAGCGGCATCTACGTGTCTGACCGCAAG
AACAAGGAGCAGGCGCCGCGCAGGGTGTTGGAGAGCACCAATGTGACGCAGATTGACATTTTGGAAGAGTACCAG
CTCCTGCTGGTGCTGAGCAACAAGACGCTGCAGTCGTACCCCCTGTCAGCATTGAATCCCGAAGAGGGCGCGCCG
GCAAGAAGACCCAAGAAGATTCAAAACCACTGCAGCTTCTTCAAGACGGGAATATGCTTGGGGCGGCACTTGGTG
TGCTGCGTCAAATCATCTGCGCTGTCGACAACCATCAAGGTGTTTGAGCCCAATGACGCCATGACCAAGGCCAAG
AAGCAGAAGGGGCTAGGCAAGCTCATGGCCGGGGGCCAGGACGAGCTCAAGCCATTCAAGGAGTTTTACATTCCG
ACCGAGTCATCGTCGGTGCATTTTCTTAAGTCGAAGCTCTGCGTGGCTTGTGCTCGTGGCTTCGAGGTGGTGTCG
CTCGAGACGCTCGAGACGCAGTCTCTACTGGACCAGGCCGACACGTCGCTCGACTTTGTTGCACGCAAGGAAAAC
GTCAAGCCGATACACATAGAGCGCCTCAATGGCGAATTTTTGCTCAACTATACCGAGTTTTCCTTTTTTGTTAAC
CGTAACGGCTGGCGAGCGCGACCCGAGTGGCGCATAGACTGGGAGGGAACGCCACAGAGCTTCGCGCTGAGCTAT
CCCTGGATTCTGGCGTTTGAGACCAACTTTATCGAGCTGCGCAACATTGAGAATGGCGCCGTGCATATCGTGCCT
CACAAGAACATTCGCATGCTGCACAGCAGCACCCACGAGGTAAGTAGTGGGCCGGCTGGCGTGGCTGACTTGCCA
TTTACTGACACTCTGGCAGATATTGTTTGCTTACGAGGATGAGCGAGGCGAGGATGTGGTTGAAGCAATTGACTT
TTGGAAGAATAAGCGTCGATCCGAGTTGCTGGCGCCGACTGCATCCACGGCGGCATCTGCGCTCCCGGCCGGTGG
CTCGCCATCAAGCCAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail