Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4973
Gene name
LocationContig_437:8640..9836
Strand+
Gene length (bp)1196
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14580 LRR_9 Leucine-rich repeat 2.7E-49 2 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9P4|RU2A_NEUCR U2 small nuclear ribonucleoprotein A' OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lea-1 PE=3 SV=1 1 244 4.0E-112
sp|Q4WV66|RU2A_ASPFU U2 small nuclear ribonucleoprotein A' OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lea1 PE=3 SV=1 1 238 1.0E-103
sp|Q5BGW9|RU2A_EMENI U2 small nuclear ribonucleoprotein A' OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lea1 PE=3 SV=1 1 243 2.0E-83
sp|Q9USX8|RU2A_SCHPO U2 small nuclear ribonucleoprotein A' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lea1 PE=1 SV=1 1 233 5.0E-65
sp|Q4P5F9|RU2A_USTMA U2 small nuclear ribonucleoprotein A' OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEA1 PE=3 SV=1 1 230 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9P4|RU2A_NEUCR U2 small nuclear ribonucleoprotein A' OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lea-1 PE=3 SV=1 1 244 4.0E-112
sp|Q4WV66|RU2A_ASPFU U2 small nuclear ribonucleoprotein A' OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lea1 PE=3 SV=1 1 238 1.0E-103
sp|Q5BGW9|RU2A_EMENI U2 small nuclear ribonucleoprotein A' OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lea1 PE=3 SV=1 1 243 2.0E-83
sp|Q9USX8|RU2A_SCHPO U2 small nuclear ribonucleoprotein A' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lea1 PE=1 SV=1 1 233 5.0E-65
sp|Q4P5F9|RU2A_USTMA U2 small nuclear ribonucleoprotein A' OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEA1 PE=3 SV=1 1 230 1.0E-46
sp|Q9V4Q8|RU2A_DROME Probable U2 small nuclear ribonucleoprotein A' OS=Drosophila melanogaster GN=U2A PE=1 SV=1 1 239 1.0E-45
sp|Q4R8Y8|RU2A_MACFA U2 small nuclear ribonucleoprotein A' OS=Macaca fascicularis GN=SNRPA1 PE=2 SV=1 1 234 4.0E-45
sp|P09661|RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens GN=SNRPA1 PE=1 SV=2 1 234 4.0E-45
sp|P57784|RU2A_MOUSE U2 small nuclear ribonucleoprotein A' OS=Mus musculus GN=Snrpa1 PE=1 SV=2 1 234 3.0E-44
sp|Q9BLB6|RU2A_CAEEL Probable U2 small nuclear ribonucleoprotein A' OS=Caenorhabditis elegans GN=mog-2 PE=1 SV=1 1 233 1.0E-41
sp|P43333|RU2A_ARATH U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana GN=At1g09760 PE=2 SV=2 1 236 7.0E-40
sp|Q6BT60|RU2A_DEBHA U2 small nuclear ribonucleoprotein A' OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LEA1 PE=3 SV=2 1 232 3.0E-35
sp|Q5A449|RU2A_CANAL U2 small nuclear ribonucleoprotein A' OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LEA1 PE=3 SV=1 1 230 1.0E-30
sp|Q6C417|RU2A_YARLI U2 small nuclear ribonucleoprotein A' OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LEA1 PE=3 SV=1 1 227 2.0E-28
sp|Q08963|RU2A_YEAST U2 small nuclear ribonucleoprotein A' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEA1 PE=1 SV=1 41 230 5.0E-12
sp|Q6FV04|RU2A_CANGA U2 small nuclear ribonucleoprotein A' OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LEA1 PE=3 SV=1 1 217 4.0E-10
sp|Q755D2|RU2A_ASHGO U2 small nuclear ribonucleoprotein A' OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEA1 PE=3 SV=1 43 230 8.0E-09
sp|Q5Y2C3|H2AY_TETTS Histone H2A.Y OS=Tetrahymena thermophila (strain SB210) GN=HTAY PE=2 SV=2 47 156 3.0E-07
sp|A8IVX2|DRC3_CHLRE Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii GN=DRC3 PE=1 SV=1 22 158 5.0E-07
sp|A2AL36|CNTRL_MOUSE Centriolin OS=Mus musculus GN=Cntrl PE=1 SV=2 45 181 7.0E-07
sp|Q8IW35|CEP97_HUMAN Centrosomal protein of 97 kDa OS=Homo sapiens GN=CEP97 PE=1 SV=1 23 164 2.0E-06
sp|Q9H2I8|CJ011_HUMAN Leucine-rich repeat-containing protein C10orf11 OS=Homo sapiens GN=C10orf11 PE=1 SV=1 20 193 4.0E-06
sp|Q9CZ62|CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus GN=Cep97 PE=1 SV=1 23 164 6.0E-06
sp|Q7Z7A1|CNTRL_HUMAN Centriolin OS=Homo sapiens GN=CNTRL PE=1 SV=2 30 181 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4973
MKLTPDLIQGALSYLNPLKERELDLRGQHIDSIENLGVAGPHDAIDFTDNDVSVLGNFPLSPRITTLLLARNRVS
SIQPSLPRAIPNLKNLVLASNDLAELADLDVLGYFARLTHLVLTDNPVTKLQHYRYWLLWRCPSVRFLDYQKVKD
AEREKSRELFGSAEEPTALATKILSTKSTFFERSAANGPAQSRLSRIKLTPEERRRIQEKIQNATNLQEIMALEK
ELNEGRLPSGIQDDDAMQE*
Coding >OphauG2|4973
ATGAAGCTCACGCCGGACCTGATCCAGGGGGCGCTGTCGTATCTCAATCCGCTCAAGGAGCGAGAACTAGACCTA
CGAGGACAGCACATTGACTCTATTGAAAACCTGGGAGTTGCGGGCCCTCACGACGCGATCGACTTTACCGACAAC
GACGTCAGCGTCCTGGGCAACTTTCCCCTCTCGCCGCGTATAACGACGCTCCTCCTCGCGCGGAACCGCGTCTCG
AGCATCCAGCCATCCCTACCGCGCGCGATTCCCAACCTCAAGAACCTGGTTCTTGCGTCGAATGACTTGGCCGAG
CTGGCTGATTTGGATGTCCTGGGCTACTTTGCGCGTCTCACGCACCTAGTCTTGACGGATAATCCCGTGACCAAG
CTCCAGCACTACCGATACTGGCTTCTCTGGCGATGTCCATCGGTCCGATTTCTCGACTATCAAAAGGTCAAGGAC
GCTGAGCGGGAAAAGAGCCGAGAATTATTCGGATCGGCAGAAGAGCCGACTGCTCTGGCAACAAAGATTCTAAGC
ACAAAGTCAACCTTTTTCGAGAGAAGCGCGGCAAACGGCCCAGCACAGTCTAGGCTGTCTCGAATCAAGCTCACG
CCCGAGGAGAGAAGGCGCATCCAAGAAAAGATTCAAAACGCCACGAATCTACAGGAAATCATGGCGCTGGAAAAG
GAGCTCAACGAGGGGCGTTTGCCATCTGGTATTCAAGACGACGACGCGATGCAAGAGTAA
Transcript >OphauG2|4973
ATGAAGCTCACGCCGGACCTGATCCAGGGGGCGCTGTCGTATCTCAATCCGCTCAAGGAGCGAGAACTAGACCTA
CGAGGACAGCACATTGACTCTATTGAAAACCTGGGAGTTGCGGGCCCTCACGACGCGATCGACTTTACCGACAAC
GACGTCAGCGTCCTGGGCAACTTTCCCCTCTCGCCGCGTATAACGACGCTCCTCCTCGCGCGGAACCGCGTCTCG
AGCATCCAGCCATCCCTACCGCGCGCGATTCCCAACCTCAAGAACCTGGTTCTTGCGTCGAATGACTTGGCCGAG
CTGGCTGATTTGGATGTCCTGGGCTACTTTGCGCGTCTCACGCACCTAGTCTTGACGGATAATCCCGTGACCAAG
CTCCAGCACTACCGATACTGGCTTCTCTGGCGATGTCCATCGGTCCGATTTCTCGACTATCAAAAGGTCAAGGAC
GCTGAGCGGGAAAAGAGCCGAGAATTATTCGGATCGGCAGAAGAGCCGACTGCTCTGGCAACAAAGATTCTAAGC
ACAAAGTCAACCTTTTTCGAGAGAAGCGCGGCAAACGGCCCAGCACAGTCTAGGCTGTCTCGAATCAAGCTCACG
CCCGAGGAGAGAAGGCGCATCCAAGAAAAGATTCAAAACGCCACGAATCTACAGGAAATCATGGCGCTGGAAAAG
GAGCTCAACGAGGGGCGTTTGCCATCTGGTATTCAAGACGACGACGCGATGCAAGAGTAA
Gene >OphauG2|4973
ATGAAGCTCACGCCGGACCTGATCCAGGGGGCGCTGTCGTATCTCAATCCGCTCAAGGAGCGAGAACTAGACCTA
CGAGGTGCGTGAAGAAAAGAAAGAAAGAAAAAAAGGAAAAGAGCAGATGCTACAGTGATCAATGGCAAAGCGAGA
GGCAAAGTTGATGCGAGCGGTGCAAGCCGTGGGTGGCTGCTGCGGCCAAATAGGACAGCACATTGACTCTATTGA
AAACCTGGGAGTTGCGGGCGTGAGTTTTCTCTTTTTCTTTTTCTTTTTTTTTTTTTTTTTCCCTGCCCGCTACGT
TGGCAACAAAAAAAAGCCCGAGGTGTAAAGCACAGAGTTTTTTTTTTTCTCCTGCTTCGAGTTACAAAAAAAGCC
CGAGGAATGGAGCACATGGTAACGAGTAACCAGCCTCACGACGCGATCGACTTTACCGACAACGACGTCAGCGTC
CTGGGCAACTTTCCCCTCTCGCCGCGTATAACGACGCTCCTCCTCGCGCGGAACCGCGTCTCGAGCATCCAGCCA
TCCCTACCGCGCGCGATTCCCAACCTCAAGAACCTGGTTCTTGCGTCGAATGACTTGGCCGAGCTGGCTGATTTG
GATGTCCTGGGCTACTTTGCGCGTCTCACGCACCTAGTCTTGACGGATAATCCCGTGACCAAGCTCCAGGTATGG
ATTTTTTTTTGGGGGGGGGTTTCTTCTTGGGCCTTTTTTTTTTGGCCGTTTGGGAAAGAGGAAGAAGAATAACAA
AACGTTAATCACAGCACTACCGATACTGGCTTCTCTGGCGATGTCCATCGGTCCGATTTCTCGACTATCAAAAGG
TCAAGGACGCTGAGCGGGAAAAGAGCCGAGAATTATTCGGATCGGCAGAAGAGCCGACTGCTCTGGCAACAAAGG
CAAGATGCTTCTTTTTTTTTCTTTTTTTTTTCTTTTTTTTTTAAAAAAAAACTCATACCATCTAACACTTCAAAC
AGATTCTAAGCACAAAGTCAACCTTTTTCGAGAGAAGCGCGGCAAACGGCCCAGCACAGTCTAGGCTGTCTCGAA
TCAAGCTCACGCCCGAGGAGAGAAGGCGCATCCAAGAAAAGATTCAAAACGCCACGAATCTACAGGAAATCATGG
CGCTGGAAAAGGAGCTCAACGAGGGGCGTTTGCCATCTGGTATTCAAGACGACGACGCGATGCAAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail