Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4963
Gene name
LocationContig_435:12036..13335
Strand-
Gene length (bp)1299
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02833 DHHA2 DHHA2 domain 1.9E-33 238 387
PF01368 DHH DHH family 1.1E-10 32 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38698|PPX1_YEAST Exopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPX1 PE=1 SV=1 1 388 3.0E-47
sp|O14094|PPX1_SCHPO Putative exopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.11 PE=3 SV=1 6 389 1.0E-40
sp|Q5E9Y6|PRUNE_BOVIN Protein prune homolog OS=Bos taurus GN=PRUNE PE=2 SV=1 8 388 9.0E-21
sp|Q86TP1|PRUNE_HUMAN Protein prune homolog OS=Homo sapiens GN=PRUNE PE=1 SV=2 29 388 3.0E-19
sp|Q6AYG3|PRUNE_RAT Protein prune homolog OS=Rattus norvegicus GN=Prune PE=1 SV=1 8 388 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38698|PPX1_YEAST Exopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPX1 PE=1 SV=1 1 388 3.0E-47
sp|O14094|PPX1_SCHPO Putative exopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.11 PE=3 SV=1 6 389 1.0E-40
sp|Q5E9Y6|PRUNE_BOVIN Protein prune homolog OS=Bos taurus GN=PRUNE PE=2 SV=1 8 388 9.0E-21
sp|Q86TP1|PRUNE_HUMAN Protein prune homolog OS=Homo sapiens GN=PRUNE PE=1 SV=2 29 388 3.0E-19
sp|Q6AYG3|PRUNE_RAT Protein prune homolog OS=Rattus norvegicus GN=Prune PE=1 SV=1 8 388 4.0E-19
sp|Q8BIW1|PRUNE_MOUSE Protein prune homolog OS=Mus musculus GN=Prune PE=1 SV=1 29 388 2.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0016462 pyrophosphatase activity Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1049
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2794
Ophiocordyceps australis 1348a (Ghana) OphauG2|4963 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7204
Ophiocordyceps camponoti-floridani Ophcf2|06314
Ophiocordyceps camponoti-rufipedis Ophun1|414
Ophiocordyceps kimflemingae Ophio5|950
Ophiocordyceps subramaniannii Hirsu2|9833

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4963
MSLPRVPLPSFLAQATAALRALSAAQPSPLTLVVGNESADLDSVCAAIVYAYLSSHRAPPRIHVPLVNLPRDDLA
IRPELTAVLLRAGLSPHCLPTLSDLPRHLAHGSACDSLAWVLVDHNAPTGIVARAATTLSGCIDHHHDENTVPLT
AHPRLIEPCASCTSLVVNLCAHDWDALSRRDSAGDASLAILAMAPILADTSNLEAKDLIRDKDLRAAAMLEAKLA
PSHDFDRTQFYNSIKSAKADLSSLSLADILRKDYKQWGDLGISSIAQSLSWLISKAGGHMPLLDSLAAWAHHRHI
KVLAIMTLHTKDGHLERQLVVWGFGPAARPIVAAFAHSASAPLRLKPWPAEAGLDSDLDDTENTRFAWSQGNCRA
SRKIVAPLLRAAFKL*
Coding >OphauG2|4963
ATGTCGTTGCCGCGAGTCCCGCTTCCCAGCTTCCTCGCTCAAGCGACGGCGGCTCTACGCGCTCTGTCGGCTGCG
CAGCCGTCGCCCTTGACTCTAGTGGTTGGCAACGAATCTGCAGACCTCGACTCGGTCTGCGCTGCCATTGTCTAC
GCCTACTTATCCTCGCACCGCGCCCCGCCTCGAATCCACGTCCCCCTCGTCAATCTCCCGCGCGACGACCTCGCC
ATCCGCCCAGAGCTTACCGCCGTCCTGCTCCGCGCCGGCTTGTCTCCACACTGCCTGCCCACCCTCTCCGACTTG
CCGCGCCACTTGGCCCATGGCTCTGCCTGCGATTCGCTTGCCTGGGTGCTTGTTGACCACAACGCCCCCACGGGC
ATCGTTGCCCGCGCCGCAACCACCCTGTCTGGCTGCATCGACCATCACCACGACGAAAACACGGTTCCACTCACC
GCTCACCCCCGCCTCATTGAGCCCTGTGCCAGCTGCACAAGCCTCGTTGTCAACCTCTGCGCACATGATTGGGAC
GCCCTCTCCCGTCGCGACTCGGCCGGAGACGCCTCCCTGGCTATTCTCGCCATGGCTCCCATCCTTGCCGATACC
TCGAATCTAGAAGCCAAGGATTTGATACGCGACAAGGATTTGCGCGCCGCAGCCATGCTCGAGGCTAAACTCGCG
CCCTCCCATGACTTTGACCGCACCCAGTTCTACAACTCCATAAAATCCGCAAAGGCAGATCTTTCCTCTCTATCC
CTTGCCGACATTCTTCGCAAAGACTATAAGCAATGGGGCGATCTTGGAATTAGCTCCATCGCTCAGAGCCTTTCC
TGGCTCATATCAAAAGCCGGCGGCCACATGCCTCTCCTAGACAGTCTGGCTGCCTGGGCCCACCACCGCCACATC
AAGGTCTTGGCCATCATGACTCTCCACACCAAGGACGGCCACCTAGAGCGCCAACTCGTTGTCTGGGGCTTTGGG
CCCGCCGCACGCCCAATTGTTGCCGCTTTTGCTCACTCTGCTTCCGCTCCCCTGCGTTTAAAGCCCTGGCCTGCT
GAAGCCGGGCTCGACTCGGACCTTGACGATACTGAAAACACCAGATTTGCCTGGTCACAGGGAAATTGTAGAGCC
AGTAGGAAAATCGTCGCGCCCTTGCTGCGTGCTGCCTTTAAGCTCTGA
Transcript >OphauG2|4963
ATGTCGTTGCCGCGAGTCCCGCTTCCCAGCTTCCTCGCTCAAGCGACGGCGGCTCTACGCGCTCTGTCGGCTGCG
CAGCCGTCGCCCTTGACTCTAGTGGTTGGCAACGAATCTGCAGACCTCGACTCGGTCTGCGCTGCCATTGTCTAC
GCCTACTTATCCTCGCACCGCGCCCCGCCTCGAATCCACGTCCCCCTCGTCAATCTCCCGCGCGACGACCTCGCC
ATCCGCCCAGAGCTTACCGCCGTCCTGCTCCGCGCCGGCTTGTCTCCACACTGCCTGCCCACCCTCTCCGACTTG
CCGCGCCACTTGGCCCATGGCTCTGCCTGCGATTCGCTTGCCTGGGTGCTTGTTGACCACAACGCCCCCACGGGC
ATCGTTGCCCGCGCCGCAACCACCCTGTCTGGCTGCATCGACCATCACCACGACGAAAACACGGTTCCACTCACC
GCTCACCCCCGCCTCATTGAGCCCTGTGCCAGCTGCACAAGCCTCGTTGTCAACCTCTGCGCACATGATTGGGAC
GCCCTCTCCCGTCGCGACTCGGCCGGAGACGCCTCCCTGGCTATTCTCGCCATGGCTCCCATCCTTGCCGATACC
TCGAATCTAGAAGCCAAGGATTTGATACGCGACAAGGATTTGCGCGCCGCAGCCATGCTCGAGGCTAAACTCGCG
CCCTCCCATGACTTTGACCGCACCCAGTTCTACAACTCCATAAAATCCGCAAAGGCAGATCTTTCCTCTCTATCC
CTTGCCGACATTCTTCGCAAAGACTATAAGCAATGGGGCGATCTTGGAATTAGCTCCATCGCTCAGAGCCTTTCC
TGGCTCATATCAAAAGCCGGCGGCCACATGCCTCTCCTAGACAGTCTGGCTGCCTGGGCCCACCACCGCCACATC
AAGGTCTTGGCCATCATGACTCTCCACACCAAGGACGGCCACCTAGAGCGCCAACTCGTTGTCTGGGGCTTTGGG
CCCGCCGCACGCCCAATTGTTGCCGCTTTTGCTCACTCTGCTTCCGCTCCCCTGCGTTTAAAGCCCTGGCCTGCT
GAAGCCGGGCTCGACTCGGACCTTGACGATACTGAAAACACCAGATTTGCCTGGTCACAGGGAAATTGTAGAGCC
AGTAGGAAAATCGTCGCGCCCTTGCTGCGTGCTGCCTTTAAGCTCTGA
Gene >OphauG2|4963
ATGTCGTTGCCGCGAGTCCCGCTTCCCAGCTTCCTCGCTCAAGCGACGGCGGCTCTACGCGCTCTGTCGGCTGCG
CAGCCGTCGCCCTTGACTCTAGTGGTTGGCAACGAATCTGCAGGTCAGTCACGTCGTGTATGCTTTTTCTTTCTT
TTTTTTTCTTTCTTCTTCTTCCTTTTCTTGTCCCTTTGCGCAAAAAGAAAAAGAAAAGAAAAAAAAAAGACTAAA
ACAACCGCCTCCGCCATAGACCTCGACTCGGTCTGCGCTGCCATTGTCTACGCCTACTTATCCTCGCACCGCGCC
CCGCCTCGAATCCACGTCCCCCTCGTCAATCTCCCGCGCGACGACCTCGCCATCCGCCCAGAGCTTACCGCCGTC
CTGCTCCGCGCCGGCTTGTCTCCACACTGCCTGCCCACCCTCTCCGACTTGCCGCGCCACTTGGCCCATGGCTCT
GCCTGCGATTCGCTTGCCTGGGTGCTTGTTGACCACAACGCCCCCACGGGCATCGTTGCCCGCGCCGCAACCACC
CTGTCTGGCTGCATCGACCATCACCACGACGAAAACACGGTTCCACTCACCGCTCACCCCCGCCTCATTGAGCCC
TGTGCCAGCTGCACAAGCCTCGTTGTCAACCTCTGCGCACATGATTGGGACGCCCTCTCCCGTCGCGACTCGGCC
GGAGACGCCTCCCTGGCTATTCTCGCCATGGCTCCCATCCTTGCCGATACCTCGAATCTAGAAGCCAAGGATTTG
ATACGCGACAAGGATTTGCGCGCCGCAGCCATGCTCGAGGCTAAACTCGCGCCCTCCCATGACTTTGACCGCACC
CAGTTCTACAACTCCATAAAATCCGCAAAGGCAGATCTTTCCTCTCTATCCCTTGCCGACATTCTTCGCAAAGAC
TATAAGCAATGGGGCGATCTTGGAATTAGCTCCATCGCTCAGAGCCTTTCCTGGCTCATATCAAAAGCCGGCGGC
CACATGCCTCTCCTAGACAGTCTGGCTGCCTGGGCCCACCACCGCCACATCAAGGTCTTGGCCATCATGACTCTC
CACACCAAGGACGGCCACCTAGAGCGCCAACTCGTTGTCTGGGGCTTTGGGCCCGCCGCACGCCCAATTGTTGCC
GCTTTTGCTCACTCTGCTTCCGCTCCCCTGCGTTTAAAGCCCTGGCCTGCTGAAGCCGGGCTCGACTCGGACCTT
GACGATACTGAAAACACCAGATTTGCCTGGTCACAGGGAAATTGTAGAGCCAGTAGGAAAATCGTCGCGCCCTTG
CTGCGTGCTGCCTTTAAGCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail