Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4962
Gene name
LocationContig_435:9828..11748
Strand+
Gene length (bp)1920
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02410 RsfS Ribosomal silencing factor during starvation 4.0E-10 120 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YY76|ATP25_NECH7 ATPase synthesis protein 25, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=ATP25 PE=3 SV=1 1 563 1.0E-166
sp|Q7SAC2|ATP25_NEUCR ATPase synthesis protein 25, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp25 PE=3 SV=1 31 303 1.0E-60
sp|D1ZCP6|ATP25_SORMK ATPase synthesis protein 25, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ATP25 PE=3 SV=1 31 296 4.0E-60
sp|C8VCP9|ATP25_EMENI ATPase synthesis protein 25, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atp25 PE=3 SV=1 63 289 2.0E-46
sp|B6HIP5|ATP25_PENRW ATPase synthesis protein 25, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atp25 PE=3 SV=1 1 290 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YY76|ATP25_NECH7 ATPase synthesis protein 25, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=ATP25 PE=3 SV=1 1 563 1.0E-166
sp|Q7SAC2|ATP25_NEUCR ATPase synthesis protein 25, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp25 PE=3 SV=1 31 303 1.0E-60
sp|D1ZCP6|ATP25_SORMK ATPase synthesis protein 25, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ATP25 PE=3 SV=1 31 296 4.0E-60
sp|C8VCP9|ATP25_EMENI ATPase synthesis protein 25, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atp25 PE=3 SV=1 63 289 2.0E-46
sp|B6HIP5|ATP25_PENRW ATPase synthesis protein 25, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atp25 PE=3 SV=1 1 290 1.0E-43
sp|A2QJZ0|ATP25_ASPNC ATPase synthesis protein 25, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atp25 PE=3 SV=1 81 295 3.0E-41
sp|B8NPX1|ATP25_ASPFN ATPase synthesis protein 25, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=atp25 PE=3 SV=1 81 296 7.0E-41
sp|C5JJY8|ATP25_AJEDS ATPase synthesis protein 25, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=ATP25 PE=3 SV=1 114 319 1.0E-40
sp|C5GAC6|ATP25_AJEDR ATPase synthesis protein 25, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=ATP25 PE=3 SV=1 114 319 2.0E-40
sp|B0XVA3|ATP25_ASPFC ATPase synthesis protein 25, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=atp25 PE=3 SV=1 66 289 8.0E-40
sp|Q4WZJ2|ATP25_ASPFU ATPase synthesis protein 25, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atp25 PE=3 SV=1 66 289 6.0E-39
sp|C1H741|ATP25_PARBA ATPase synthesis protein 25, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=ATP25 PE=3 SV=1 1 280 2.0E-38
sp|C6HBY6|ATP25_AJECH ATPase synthesis protein 25, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=ATP25 PE=3 SV=1 1 283 2.0E-37
sp|B8MPW2|ATP25_TALSN ATPase synthesis protein 25, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=atp25 PE=3 SV=1 71 276 2.0E-37
sp|B6Q2V1|ATP25_TALMQ ATPase synthesis protein 25, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=atp25 PE=3 SV=1 56 306 9.0E-37
sp|C5PDQ4|ATP25_COCP7 ATPase synthesis protein 25, mitochondrial OS=Coccidioides posadasii (strain C735) GN=ATP25 PE=3 SV=1 1 278 1.0E-35
sp|C4JUR0|ATP25_UNCRE ATPase synthesis protein 25, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=ATP25 PE=3 SV=1 1 278 6.0E-35
sp|C0NWC4|ATP25_AJECG ATPase synthesis protein 25, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=ATP25 PE=3 SV=1 114 283 2.0E-34
sp|C1FZ15|ATP25_PARBD ATPase synthesis protein 25, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=ATP25 PE=3 SV=2 1 283 5.0E-33
sp|C0S4K1|ATP25_PARBP ATPase synthesis protein 25, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=ATP25 PE=3 SV=2 1 283 1.0E-32
sp|A1DIN7|ATP25_NEOFI ATPase synthesis protein 25, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atp25 PE=3 SV=1 71 288 1.0E-31
sp|Q0U2C0|ATP25_PHANO ATPase synthesis protein 25, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATP25 PE=3 SV=2 78 280 2.0E-30
sp|D4B478|ATP25_ARTBC ATPase synthesis protein 25, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ATP25 PE=3 SV=1 1 281 2.0E-29
sp|D4D5X3|ATP25_TRIVH ATPase synthesis protein 25, mitochondrial OS=Trichophyton verrucosum (strain HKI 0517) GN=ATP25 PE=3 SV=1 1 281 1.0E-28
sp|Q7SAC2|ATP25_NEUCR ATPase synthesis protein 25, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp25 PE=3 SV=1 332 551 7.0E-20
sp|D1ZCP6|ATP25_SORMK ATPase synthesis protein 25, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ATP25 PE=3 SV=1 332 551 1.0E-18
sp|Q6CLH6|ATP25_KLULA ATPase synthesis protein 25, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP25 PE=3 SV=1 80 276 3.0E-11
sp|C4QZ25|ATP25_PICPG ATPase synthesis protein 25, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ATP25 PE=3 SV=1 64 276 5.0E-11
sp|C5DZB2|ATP25_ZYGRC ATPase synthesis protein 25, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ATP25 PE=3 SV=1 66 301 1.0E-09
sp|A7TQF7|ATP25_VANPO ATPase synthesis protein 25, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATP25 PE=3 SV=1 34 201 8.0E-09
sp|A5D9T6|ATP25_PICGU ATPase synthesis protein 25, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATP25 PE=3 SV=2 31 276 4.0E-08
sp|Q6BXN8|ATP25_DEBHA ATPase synthesis protein 25, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATP25 PE=3 SV=2 69 276 6.0E-07
sp|Q75DR7|ATP25_ASHGO ATPase synthesis protein 25, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP25 PE=3 SV=2 80 308 1.0E-06
sp|B8NPX1|ATP25_ASPFN ATPase synthesis protein 25, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=atp25 PE=3 SV=1 383 523 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1048
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4962 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7202
Ophiocordyceps australis map64 (Brazil) OphauB2|7203
Ophiocordyceps camponoti-floridani Ophcf2|06315
Ophiocordyceps camponoti-rufipedis Ophun1|415
Ophiocordyceps kimflemingae Ophio5|951
Ophiocordyceps subramaniannii Hirsu2|9832

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4962
MSRPAIATLGCFGCQTAILRAVLGRNLAVLPRRLQLPPALVSSQRRAQSTLEKRDDVPDTLLDDAPKAGATDEDQ
GATEKPWFLDIEPPRHARSLFAQKIPKAPQDAPSLLDPMIKYVYQDMGLDDLALFDLRQLDPPASLGPNLIMLFG
TARSERHLHICSGRFARWLRRTFGVDASADGLIGAGELKTKLRRIRKKAKLLGNNSMIIPQGDNGLSTGWVCVKF
TTSADKRHESTDFDEHGRMTGFGAGAVTGTRVVIQCMTEARRTELDLEGLWEGVLGRSIERRKKIEGFSPNYETD
IQPLDNKDVFRHKQGHYKPQWNPRASSQIKTKQLQLSGACISQEMLEKLIAAVLRVESSLPETASQRLALLDQLL
LTGHERGLSIWSTDMLVKLISMVVASPAYGPELQRTQKNLELLLVETMTSPLEQDQVFCLLEVYAMRRDWDRFWH
TFHSPVRFQQDRWPALYEFAFSALAATGDARLCADALRWLLPEMLNEPRPMPLSTPLYSCLKACILAADPMAEDL
LHNPPDTHGVRLSESRRLQRREFVRVLGEVEVLRRQWLDQEARSKL*
Coding >OphauG2|4962
ATGTCGCGGCCAGCAATTGCCACTCTTGGTTGCTTTGGGTGTCAAACAGCCATTCTGAGGGCTGTGCTTGGCCGC
AACTTGGCCGTGCTTCCTCGCAGGCTGCAGCTCCCGCCAGCGCTCGTGTCCTCGCAGAGACGTGCACAATCGACG
TTGGAGAAGCGAGACGATGTACCGGACACTCTTTTGGACGACGCACCAAAAGCTGGCGCAACGGACGAGGATCAA
GGTGCCACGGAGAAACCATGGTTTCTCGACATTGAGCCCCCTCGCCATGCTCGGAGCTTATTCGCGCAAAAAATC
CCCAAGGCGCCTCAGGATGCACCCTCACTGCTGGACCCCATGATCAAATATGTTTATCAAGACATGGGACTCGAT
GACTTGGCTCTGTTTGATTTACGGCAATTGGATCCGCCAGCCTCCCTCGGCCCCAACCTAATCATGCTTTTTGGC
ACGGCACGCAGCGAGAGACACCTGCACATTTGCTCCGGCCGCTTTGCGCGCTGGCTGCGGCGCACCTTTGGTGTT
GATGCTTCGGCCGATGGGTTGATTGGTGCAGGCGAGCTCAAGACAAAGTTGCGCCGCATCAGAAAAAAGGCCAAA
CTCTTGGGCAACAACTCCATGATTATACCTCAAGGAGATAACGGCCTCTCAACTGGCTGGGTCTGCGTCAAGTTC
ACTACAAGTGCCGATAAGCGCCACGAAAGCACTGATTTTGATGAGCATGGGAGAATGACGGGATTTGGTGCTGGT
GCTGTCACTGGTACCAGAGTCGTGATACAGTGCATGACGGAAGCACGCAGGACTGAACTTGACCTCGAAGGGCTT
TGGGAGGGCGTCCTAGGAAGAAGTATTGAACGCAGAAAGAAGATTGAGGGCTTTAGCCCGAATTACGAAACGGAT
ATTCAGCCACTTGACAACAAAGACGTTTTTCGACACAAGCAAGGTCATTACAAGCCCCAATGGAACCCCAGAGCC
TCGAGTCAAATCAAGACGAAGCAGTTGCAACTCTCTGGAGCTTGCATTAGCCAAGAAATGTTGGAGAAGCTTATA
GCTGCTGTGCTTAGAGTTGAAAGCTCTTTACCCGAGACAGCATCGCAGCGGCTTGCCCTCTTGGACCAGCTGCTA
TTGACTGGACACGAGCGCGGTTTAAGTATTTGGTCCACGGATATGCTTGTGAAGCTGATTTCAATGGTGGTGGCC
TCCCCCGCCTACGGTCCAGAGCTTCAGCGCACGCAGAAAAACTTGGAGCTCCTCCTTGTCGAGACCATGACTTCG
CCCCTCGAGCAAGATCAGGTCTTTTGCCTCTTGGAGGTATACGCCATGCGCAGAGACTGGGACCGCTTCTGGCAC
ACATTCCACTCACCTGTGCGCTTCCAACAGGATCGTTGGCCTGCCCTCTACGAGTTTGCGTTTAGCGCCTTGGCA
GCGACAGGTGACGCGCGGCTTTGTGCTGATGCGCTGCGCTGGCTTCTCCCCGAAATGCTGAATGAGCCTCGGCCC
ATGCCTCTGTCTACTCCTCTTTACTCTTGTTTGAAAGCATGCATCTTGGCTGCTGATCCCATGGCGGAGGATCTG
CTGCATAATCCGCCGGACACGCATGGCGTGCGGCTTTCTGAGAGTCGCAGGCTGCAGCGGCGAGAGTTTGTGCGC
GTACTTGGCGAGGTTGAAGTGCTTCGGCGGCAGTGGCTCGACCAAGAGGCGCGTAGCAAGCTGTGA
Transcript >OphauG2|4962
ATGTCGCGGCCAGCAATTGCCACTCTTGGTTGCTTTGGGTGTCAAACAGCCATTCTGAGGGCTGTGCTTGGCCGC
AACTTGGCCGTGCTTCCTCGCAGGCTGCAGCTCCCGCCAGCGCTCGTGTCCTCGCAGAGACGTGCACAATCGACG
TTGGAGAAGCGAGACGATGTACCGGACACTCTTTTGGACGACGCACCAAAAGCTGGCGCAACGGACGAGGATCAA
GGTGCCACGGAGAAACCATGGTTTCTCGACATTGAGCCCCCTCGCCATGCTCGGAGCTTATTCGCGCAAAAAATC
CCCAAGGCGCCTCAGGATGCACCCTCACTGCTGGACCCCATGATCAAATATGTTTATCAAGACATGGGACTCGAT
GACTTGGCTCTGTTTGATTTACGGCAATTGGATCCGCCAGCCTCCCTCGGCCCCAACCTAATCATGCTTTTTGGC
ACGGCACGCAGCGAGAGACACCTGCACATTTGCTCCGGCCGCTTTGCGCGCTGGCTGCGGCGCACCTTTGGTGTT
GATGCTTCGGCCGATGGGTTGATTGGTGCAGGCGAGCTCAAGACAAAGTTGCGCCGCATCAGAAAAAAGGCCAAA
CTCTTGGGCAACAACTCCATGATTATACCTCAAGGAGATAACGGCCTCTCAACTGGCTGGGTCTGCGTCAAGTTC
ACTACAAGTGCCGATAAGCGCCACGAAAGCACTGATTTTGATGAGCATGGGAGAATGACGGGATTTGGTGCTGGT
GCTGTCACTGGTACCAGAGTCGTGATACAGTGCATGACGGAAGCACGCAGGACTGAACTTGACCTCGAAGGGCTT
TGGGAGGGCGTCCTAGGAAGAAGTATTGAACGCAGAAAGAAGATTGAGGGCTTTAGCCCGAATTACGAAACGGAT
ATTCAGCCACTTGACAACAAAGACGTTTTTCGACACAAGCAAGGTCATTACAAGCCCCAATGGAACCCCAGAGCC
TCGAGTCAAATCAAGACGAAGCAGTTGCAACTCTCTGGAGCTTGCATTAGCCAAGAAATGTTGGAGAAGCTTATA
GCTGCTGTGCTTAGAGTTGAAAGCTCTTTACCCGAGACAGCATCGCAGCGGCTTGCCCTCTTGGACCAGCTGCTA
TTGACTGGACACGAGCGCGGTTTAAGTATTTGGTCCACGGATATGCTTGTGAAGCTGATTTCAATGGTGGTGGCC
TCCCCCGCCTACGGTCCAGAGCTTCAGCGCACGCAGAAAAACTTGGAGCTCCTCCTTGTCGAGACCATGACTTCG
CCCCTCGAGCAAGATCAGGTCTTTTGCCTCTTGGAGGTATACGCCATGCGCAGAGACTGGGACCGCTTCTGGCAC
ACATTCCACTCACCTGTGCGCTTCCAACAGGATCGTTGGCCTGCCCTCTACGAGTTTGCGTTTAGCGCCTTGGCA
GCGACAGGTGACGCGCGGCTTTGTGCTGATGCGCTGCGCTGGCTTCTCCCCGAAATGCTGAATGAGCCTCGGCCC
ATGCCTCTGTCTACTCCTCTTTACTCTTGTTTGAAAGCATGCATCTTGGCTGCTGATCCCATGGCGGAGGATCTG
CTGCATAATCCGCCGGACACGCATGGCGTGCGGCTTTCTGAGAGTCGCAGGCTGCAGCGGCGAGAGTTTGTGCGC
GTACTTGGCGAGGTTGAAGTGCTTCGGCGGCAGTGGCTCGACCAAGAGGCGCGTAGCAAGCTGTGA
Gene >OphauG2|4962
ATGTCGCGGCCAGCAATTGCCACTCTTGGTTGCTTTGGGTGTCAAACAGCCATTCTGAGGGCTGTGCTTGGCCGC
AACTTGGCCGTGCTTCCTCGCAGGCTGCAGCTCCCGCCAGCGCTCGTGTCCTCGCAGAGACGTGCACAATCGACG
TTGGAGAAGCGAGACGATGTACCGGACACTCTTTTGGACGACGCACCAAAAGCTGGCGCAACGGACGAGGATCAA
GGTGCCACGGAGAAACCATGGTTTCTCGACATTGAGCCCCCTCGCCATGCTCGGAGCTTATTCGCGCAAAAAATC
CCCAAGGCGCCTCAGGATGCACCCTCACTGCTGGACCCCATGATCAAATATGTTTATCAAGACATGGGACTCGAT
GACTTGGCTCTGTTTGATTTACGGCAATTGGATCCGCCAGCCTCCCTCGGCCCCAACCTAATCATGCTTTTTGGC
ACGGCACGCAGCGAGAGACACCTGCACATTTGCTCCGGCCGCTTTGCGCGCTGGCTGCGGCGCACCTTTGGTGTT
GATGCTTCGGCCGATGGGTTGATTGGTGCAGGCGAGCTCAAGACAAAGTTGCGCCGCATCAGAAAAAAGGCCAAA
CTCTTGGGCAACAACTCCATGATTATACCTCAAGGAGATAACGGCCTCTCAACTGGCTGGGTCTGCGTCAAGTTC
ACTACAAGTGCCGATAAGCGCCACGAAAGCACTGATTTTGATGAGCATGGGAGAATGACGGGATTTGGTGCTGGT
GCTGTCACTGGTACCAGAGTCGTGATACAGTGCATGACGGAAGCACGCAGGACTGAACTTGACCTCGAAGGGCTT
TGGGAGGGCGTCCTAGGAAGAAGTATTGAACGCAGAAAGAAGATTGAGGGCTTTAGCCCGAATTACGAAACGGAT
ATTCAGCCACTTGTCTCATCCTACATCCAATTACCCTCTCAACCACCTCAACCATCTCTGCCATCTCTGCCATCT
CAATCGTTTCCATCACCACAATCGTCCCAATCGTCTCAATCTTCTCTCGCAGCAATGTCAATGACAATAGGACAA
CAAAGACGTTTTTCGACACAAGCAAGGTCATTACAAGCCCCAATGGAACCCCAGAGCCTCGAGTCAAATCAAGGT
TTGCACCCACCCGAGCCAGTCTTGCCAACAGAAGCAACCGAGGATAACTTGGGTATTCTATGCCAACAGACGAAG
CAGTTGCAACTCTCTGGAGCTTGCATTAGCCAAGAAATGTTGGAGAAGCTTATAGCTGCTGTGCTTAGAGTTGAA
AGCTCTTTACCCGAGACAGCATCGCAGCGGCTTGCCCTCTTGGACCAGCTGCTATTGACTGGACACGAGCGCGGT
TTAAGTATTTGGTCCACGGATATGCTTGTGAAGCTGATTTCAATGGTGGTGGCCTCCCCCGCCTACGGTCCAGAG
CTTCAGCGCACGCAGAAAAACTTGGAGCTCCTCCTTGTCGAGACCATGACTTCGCCCCTCGAGCAAGATCAGGTC
TTTTGCCTCTTGGAGGTATACGCCATGCGCAGAGACTGGGACCGCTTCTGGCACACATTCCACTCACCTGTGCGC
TTCCAACAGGATCGTTGGCCTGCCCTCTACGAGTTTGCGTTTAGCGCCTTGGCAGCGACAGGTGACGCGCGGCTT
TGTGCTGATGCGCTGCGCTGGCTTCTCCCCGAAATGCTGAATGAGCCTCGGCCCATGCCTCTGTCTACTCCTCTT
TACTCTTGTTTGAAAGCATGCATCTTGGCTGCTGATCCCATGGCGGAGGATCTGCTGCATAATCCGCCGGACACG
CATGGCGTGCGGCTTTCTGAGAGTCGCAGGCTGCAGCGGCGAGAGTTTGTGCGCGTACTTGGCGAGGTTGAAGTG
CTTCGGCGGCAGTGGCTCGACCAAGAGGCGCGTAGCAAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail