Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4961
Gene name
LocationContig_435:5125..9463
Strand-
Gene length (bp)4338
Transcript length (bp)4029
Coding sequence length (bp)4029
Protein length (aa) 1343

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00940 RNA_pol DNA-dependent RNA polymerase 3.1E-184 736 1342
PF14700 RPOL_N DNA-directed RNA polymerase N-terminal 2.2E-84 284 612

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13433|RPOM_YEAST DNA-directed RNA polymerase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO41 PE=1 SV=2 284 1220 0.0E+00
sp|O13993|RPOM_SCHPO DNA-directed RNA polymerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpo41 PE=3 SV=2 281 1144 0.0E+00
sp|P38671|RPOM_NEUCR DNA-directed RNA polymerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-5 PE=3 SV=2 86 1342 0.0E+00
sp|Q9LFV6|RPOT2_ARATH DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RPOT2 PE=1 SV=1 473 1138 1.0E-145
sp|Q8L6J3|RPO2B_TOBAC DNA-directed RNA polymerase 2B, chloroplastic/mitochondrial OS=Nicotiana tabacum GN=RPOT2-TOM PE=2 SV=2 346 1142 1.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13433|RPOM_YEAST DNA-directed RNA polymerase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO41 PE=1 SV=2 284 1220 0.0E+00
sp|O13993|RPOM_SCHPO DNA-directed RNA polymerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpo41 PE=3 SV=2 281 1144 0.0E+00
sp|P38671|RPOM_NEUCR DNA-directed RNA polymerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-5 PE=3 SV=2 86 1342 0.0E+00
sp|Q9LFV6|RPOT2_ARATH DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RPOT2 PE=1 SV=1 473 1138 1.0E-145
sp|Q8L6J3|RPO2B_TOBAC DNA-directed RNA polymerase 2B, chloroplastic/mitochondrial OS=Nicotiana tabacum GN=RPOT2-TOM PE=2 SV=2 346 1142 1.0E-143
sp|Q8VWF8|RPOT2_NICSY DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Nicotiana sylvestris GN=RPOT2 PE=2 SV=2 326 1142 2.0E-143
sp|P92969|RPOT1_ARATH DNA-directed RNA polymerase 1, mitochondrial OS=Arabidopsis thaliana GN=RPOT1 PE=2 SV=1 323 1139 2.0E-142
sp|P69242|RPOT3_NICSY DNA-directed RNA polymerase 3, chloroplastic OS=Nicotiana sylvestris GN=RPOT3 PE=2 SV=1 390 1142 2.0E-141
sp|P69243|RPO3A_TOBAC DNA-directed RNA polymerase 3A, chloroplastic OS=Nicotiana tabacum GN=RPOT3-SYL PE=3 SV=1 390 1142 2.0E-141
sp|Q8L6J5|RPO1B_TOBAC DNA-directed RNA polymerase 1B, mitochondrial OS=Nicotiana tabacum GN=RPOT1-TOM PE=2 SV=2 412 1139 8.0E-141
sp|O24600|RPOT3_ARATH DNA-directed RNA polymerase 3, chloroplastic OS=Arabidopsis thaliana GN=RPOT3 PE=2 SV=1 473 1147 2.0E-139
sp|Q93Y94|RPOT1_NICSY DNA-directed RNA polymerase 1, mitochondrial OS=Nicotiana sylvestris GN=RPOT1 PE=2 SV=1 412 1139 3.0E-139
sp|Q8L6J1|RPO3B_TOBAC DNA-directed RNA polymerase 3B, chloroplastic OS=Nicotiana tabacum GN=RPOT3-TOM PE=2 SV=2 390 1142 3.0E-136
sp|Q8BKF1|RPOM_MOUSE DNA-directed RNA polymerase, mitochondrial OS=Mus musculus GN=Polrmt PE=1 SV=1 341 1141 4.0E-133
sp|O00411|RPOM_HUMAN DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens GN=POLRMT PE=1 SV=2 462 1135 9.0E-133
sp|Q8L6J2|RPO2A_TOBAC DNA-directed RNA polymerase 2A (Fragment) OS=Nicotiana tabacum GN=RPOT2-SYL PE=3 SV=1 794 1142 5.0E-76
sp|Q7Y2D9|RPOL_BPKMV DNA-directed RNA polymerase OS=Enterobacteria phage phiKMV GN=gp26 PE=3 SV=1 555 1131 3.0E-65
sp|P18147|RPOL_BPK11 DNA-directed RNA polymerase OS=Enterobacteria phage K11 GN=1 PE=3 SV=1 473 1138 1.0E-62
sp|P07659|RPOL_BPT3 DNA-directed RNA polymerase OS=Enterobacteria phage T3 GN=1 PE=3 SV=1 554 1138 4.0E-61
sp|P00573|RPOL_BPT7 T7 RNA polymerase OS=Enterobacteria phage T7 GN=1 PE=1 SV=2 554 1138 3.0E-60
sp|P06221|RPOL_BPSP6 DNA-directed RNA polymerase OS=Enterobacteria phage SP6 PE=2 SV=1 401 1141 3.0E-54
sp|P33540|RPOP_NEUCS Probable DNA-directed RNA polymerase OS=Neurospora crassa PE=3 SV=1 678 1128 5.0E-40
sp|P22372|RPOP_CLAPU Probable DNA-directed RNA polymerase OS=Claviceps purpurea PE=3 SV=1 552 1129 3.0E-35
sp|P33539|RPOP_AGABT Probable DNA-directed RNA polymerase OS=Agaricus bitorquis PE=3 SV=1 552 1129 6.0E-34
sp|Q8L6J4|RPO1A_TOBAC DNA-directed RNA polymerase 1A (Fragment) OS=Nicotiana tabacum GN=RPOT1-SYL PE=3 SV=2 1023 1139 1.0E-31
sp|P33541|RPOP_NEUIN Probable DNA-directed RNA polymerase OS=Neurospora intermedia PE=3 SV=2 682 1139 6.0E-30
sp|O03685|RPOP_GELSP Probable DNA-directed RNA polymerase OS=Gelasinospora sp. (strain G114) PE=3 SV=1 683 1139 5.0E-27
sp|Q01521|RPOP_PODAS Probable DNA-directed RNA polymerase OS=Podospora anserina PE=3 SV=1 549 906 6.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0046483 heterocycle metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032774 RNA biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0090304 nucleic acid metabolic process No
GO:0016740 transferase activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4664
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4961 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7201
Ophiocordyceps camponoti-floridani Ophcf2|06316
Ophiocordyceps camponoti-rufipedis Ophun1|7279
Ophiocordyceps kimflemingae Ophio5|952
Ophiocordyceps subramaniannii Hirsu2|9831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4961
MVLSRQARGRLPVPRTTPTRPSLLPLKICTPLWPYRRLESDPSSFLVHERGMATAVNDYRVDSSMYNPINSPAMS
PFIHSSLLVPKTNKFGVPGDVLDLLPMFDACIQVKKIQRAAEVLKRLSGLPNLSDEELIILHNRFLKASVDAMRL
STDRSNAEDLHTWRYMEMAPRHSALNVLSIAEILSDTDLAVITKLFPAYNYIKTIEDDQEVAESHNDMAPYQAVE
SELPEMPLDEVESEEADQILETKQRGGSLHLLKKELSIFDRLENVDISQLPESERLELQRRLERNSIEAAIAKWR
VTNNQLLKMGKVSALGTSSNNRLSRLISKWFYAMEKQLVEELELVKVSEERSRSSLDRQRCLFGPLLQQSDPGRL
AALTILCVINNGALAGVDRGLGVSNLVHTISARVQEDIETQKLEMAKKHRKRKHLLEYVERKQKTKPITLDESPE
VEKWLDDESAPLDPSEAEQRGRWSNRARAYTGSILLKTLVETAKVDVKMRHPQTGELVTQSQPAFTHMQRPRKGK
KIGTLVFNPAVTELLRSEPIGDYLAKQLPMITKPRPWTSFDKGGFFYSKTSFVRVKQGDEEQRLYTEAAIRCGNM
RQIFKGLDVLGRTAWKINEPLLKVMMEAWNSGQGIANMPPLEPTVPQPPEPPTDAPPHERYRWMRALKVVENEKA
GLHSQRCYMNLQLEVARAFRKQTIYFPHNVDYRGRTYPIPTYLNHMGADHTRAVLVFAERRKLGTRGLKWLKIHL
ANVYGLDKSSLSEREKFTDEHTQDIIESASNPLNGRRWWLKAEDPWQCLGACMELKAALDLADPTEFLSSLPIHQ
DGTCNGLQHYAALGGDLWGAKQVNLEPGDRPADVYSAVADLVKADIEKDAAGDNTYAKVLQGKITRKVVKQTVMT
NVYGVTFVGAKKQVCKQLDDLYPDLGKEYGLPNIVLATYVAKLIFGALATMFKGAHDIQHWLGDIGSRVSRALTP
TQLNQLSDAYRKGSGDDEMVLRKGKIIRASDLKSFEDLAAQFRSTIVWTTPLRMPVVQPYRKCTSREIRTCFQAL
SFPIHGHANMIDRRKQLQGFPPNFIHSLDASHMLLSALKCDELGLTFAAVHDSFWTHAADIDVMNAVLREAFINI
HQDDVVGRLADEFRTRHDGSIYLARVETNSPAGKEIKELRKKIKRSAVEELLLEHKRLTLMRSSDPLDRETAKQI
ITPASIYEKAEEKSDIAAIEDAKLLSLGKISENERAGDEGQAESDEESESASGEEGLDLEAEADMDMSSEDITSD
AVHMMQELLSRASTPSFESQLHGYNKKAVKPKKKPTIKVWLPLTIPKIPEKGEFDVKRLRQSQYFFS*
Coding >OphauG2|4961
ATGGTGCTCTCACGACAAGCTCGCGGCCGCCTTCCTGTGCCTCGCACCACTCCCACTCGGCCATCTCTTTTGCCG
CTCAAAATCTGCACACCACTCTGGCCGTACCGCCGACTGGAGTCCGACCCCAGCTCCTTCCTTGTTCACGAACGA
GGCATGGCAACGGCTGTCAATGACTATAGAGTCGACTCGTCCATGTACAATCCAATCAACTCTCCAGCAATGTCG
CCCTTCATCCATTCATCCCTATTGGTGCCCAAGACCAACAAATTCGGCGTCCCAGGAGACGTATTAGACTTACTT
CCCATGTTCGACGCCTGCATTCAAGTCAAAAAAATCCAACGCGCGGCCGAAGTCCTTAAACGCCTCAGTGGTCTT
CCTAATCTCTCCGACGAGGAGCTCATCATCCTACATAATCGCTTTTTGAAGGCATCCGTTGATGCCATGCGCTTG
AGCACCGATCGATCAAACGCTGAAGATTTGCACACGTGGCGCTACATGGAAATGGCTCCGCGCCATTCTGCGCTC
AATGTCCTGAGCATAGCCGAAATCCTCAGCGACACAGACCTCGCCGTTATAACTAAACTCTTTCCTGCATACAAT
TACATTAAGACGATTGAAGATGACCAAGAAGTCGCAGAATCTCATAATGACATGGCGCCTTATCAAGCCGTTGAA
TCTGAATTACCTGAAATGCCTCTGGACGAGGTTGAATCAGAAGAAGCCGACCAAATCCTGGAAACTAAGCAGCGT
GGTGGAAGTCTGCATCTACTCAAGAAGGAACTTTCCATTTTCGACCGGCTGGAGAATGTCGACATCTCCCAACTC
CCCGAGTCTGAGCGCCTTGAACTACAGCGGCGGCTCGAACGCAATTCAATTGAAGCGGCAATTGCCAAGTGGCGA
GTAACCAATAATCAGCTTCTCAAGATGGGCAAAGTCTCAGCTCTAGGAACTTCTTCAAACAACCGCCTCTCTAGA
CTCATCTCCAAGTGGTTTTACGCCATGGAGAAACAGCTTGTCGAAGAACTTGAACTTGTTAAAGTCTCGGAGGAG
CGTTCCAGAAGTTCCTTGGACAGACAACGCTGTCTTTTTGGCCCTCTCCTACAGCAATCTGACCCTGGCCGCCTA
GCTGCCTTGACAATTCTCTGCGTCATAAACAATGGCGCCCTCGCTGGTGTCGACAGGGGATTGGGAGTCAGTAAC
CTTGTCCACACCATCTCTGCCAGAGTTCAGGAAGATATTGAGACACAGAAATTAGAAATGGCAAAGAAGCATCGA
AAGAGGAAACATCTGCTCGAGTACGTCGAGAGAAAGCAAAAGACTAAACCCATAACCCTAGACGAATCGCCCGAG
GTGGAAAAATGGCTCGATGATGAGTCGGCTCCGTTGGACCCAAGCGAAGCTGAACAAAGAGGTCGCTGGTCAAAC
CGAGCCAGAGCTTATACTGGCTCCATTCTCCTCAAGACCCTTGTCGAGACAGCAAAAGTTGATGTAAAGATGCGA
CATCCGCAAACTGGAGAACTCGTTACCCAATCGCAGCCGGCCTTTACTCACATGCAGCGGCCTCGAAAGGGAAAG
AAAATTGGCACCTTGGTCTTCAATCCGGCCGTGACAGAATTACTTCGAAGTGAGCCGATAGGCGATTACCTGGCG
AAGCAGCTGCCCATGATTACCAAACCGAGGCCTTGGACCTCATTTGACAAAGGTGGCTTCTTTTACAGCAAGACT
TCTTTTGTACGTGTCAAACAGGGCGATGAAGAGCAGAGACTGTACACAGAAGCCGCTATCAGGTGTGGGAATATG
CGACAAATCTTCAAAGGACTAGATGTCCTTGGACGAACAGCATGGAAGATTAATGAGCCCTTGCTCAAGGTGATG
ATGGAGGCTTGGAACTCTGGCCAAGGTATTGCAAACATGCCACCCCTCGAGCCAACCGTGCCACAGCCTCCAGAG
CCCCCGACAGATGCGCCGCCACATGAACGCTATCGGTGGATGCGGGCGCTCAAGGTAGTTGAAAACGAAAAGGCA
GGGCTGCACTCGCAGCGCTGCTACATGAATTTGCAGCTTGAAGTTGCACGGGCCTTTCGCAAGCAAACCATTTAT
TTTCCACACAATGTCGACTATCGCGGCAGAACATATCCAATTCCAACCTATCTCAACCACATGGGAGCCGATCAC
ACGCGAGCCGTTCTTGTTTTTGCCGAAAGAAGGAAGCTGGGGACGCGTGGCCTGAAATGGCTCAAGATACATCTC
GCCAACGTGTATGGCCTCGACAAATCGAGTCTATCAGAACGAGAAAAATTCACGGATGAACATACACAAGACATT
ATCGAATCGGCAAGTAATCCTCTCAATGGGCGTCGCTGGTGGCTGAAAGCCGAAGACCCGTGGCAATGCCTAGGA
GCCTGTATGGAGCTCAAGGCGGCACTCGACCTGGCCGACCCAACAGAATTTCTCTCAAGTCTCCCCATCCACCAA
GACGGCACTTGCAACGGCCTGCAGCATTATGCAGCATTGGGTGGCGACTTGTGGGGTGCCAAGCAAGTCAACTTG
GAGCCTGGCGACCGGCCTGCCGATGTCTACTCTGCAGTTGCCGACCTCGTCAAGGCAGACATTGAAAAGGATGCC
GCGGGCGACAACACCTATGCCAAGGTGCTCCAAGGCAAAATCACGCGCAAGGTTGTCAAACAGACTGTCATGACC
AATGTCTATGGCGTGACGTTTGTGGGTGCCAAGAAGCAAGTATGCAAGCAACTGGACGACTTGTATCCCGACCTG
GGAAAGGAATATGGCCTTCCCAACATAGTATTGGCCACATATGTGGCCAAGCTGATTTTTGGCGCCCTCGCCACC
ATGTTCAAGGGTGCACATGATATTCAACACTGGCTGGGCGACATTGGGAGCAGGGTGAGCCGAGCCCTGACGCCT
ACACAGCTCAATCAACTTAGCGATGCATATCGCAAAGGATCCGGTGATGACGAAATGGTGTTGAGAAAGGGCAAG
ATCATCAGGGCTTCTGATTTGAAATCATTCGAGGACCTTGCGGCACAATTCCGGTCAACAATTGTGTGGACGACA
CCTTTGCGAATGCCAGTGGTGCAACCATACCGGAAATGCACCTCTAGGGAGATTCGCACCTGTTTCCAGGCACTC
TCGTTTCCCATACACGGCCATGCCAATATGATCGACCGCAGAAAACAGCTACAGGGATTTCCCCCAAATTTCATC
CACTCACTCGACGCCAGCCACATGCTTTTGTCTGCTTTGAAATGCGACGAGCTTGGTCTCACCTTTGCTGCTGTC
CATGACTCGTTTTGGACCCACGCCGCCGACATTGATGTCATGAATGCTGTGCTTCGCGAAGCTTTTATCAACATT
CATCAAGACGATGTGGTTGGTCGTCTGGCTGACGAATTCAGGACTCGTCACGACGGTTCCATCTATCTGGCAAGA
GTTGAGACGAATTCACCGGCGGGAAAAGAAATCAAGGAGCTTCGGAAGAAGATCAAGAGGTCGGCAGTGGAGGAG
CTGCTGCTCGAACATAAACGCCTCACGCTGATGAGATCATCGGATCCTCTTGACCGCGAAACGGCCAAGCAAATA
ATAACCCCGGCATCTATTTATGAAAAGGCGGAGGAAAAGTCTGACATAGCGGCCATTGAAGATGCCAAGCTCTTA
TCTCTGGGTAAAATTAGTGAGAACGAGAGGGCTGGCGATGAGGGACAAGCAGAATCCGATGAGGAATCGGAATCG
GCCAGTGGCGAGGAGGGATTGGATCTAGAAGCAGAAGCGGATATGGACATGAGTAGTGAGGATATAACGTCGGAC
GCAGTGCACATGATGCAGGAGTTGCTCAGTCGTGCGAGCACGCCATCGTTTGAGTCCCAGCTGCATGGGTACAAC
AAGAAGGCTGTAAAGCCGAAGAAGAAGCCAACTATAAAAGTCTGGCTGCCCCTTACTATTCCGAAGATTCCCGAA
AAGGGTGAATTCGACGTCAAGCGGCTACGTCAAAGCCAATATTTCTTTTCATAG
Transcript >OphauG2|4961
ATGGTGCTCTCACGACAAGCTCGCGGCCGCCTTCCTGTGCCTCGCACCACTCCCACTCGGCCATCTCTTTTGCCG
CTCAAAATCTGCACACCACTCTGGCCGTACCGCCGACTGGAGTCCGACCCCAGCTCCTTCCTTGTTCACGAACGA
GGCATGGCAACGGCTGTCAATGACTATAGAGTCGACTCGTCCATGTACAATCCAATCAACTCTCCAGCAATGTCG
CCCTTCATCCATTCATCCCTATTGGTGCCCAAGACCAACAAATTCGGCGTCCCAGGAGACGTATTAGACTTACTT
CCCATGTTCGACGCCTGCATTCAAGTCAAAAAAATCCAACGCGCGGCCGAAGTCCTTAAACGCCTCAGTGGTCTT
CCTAATCTCTCCGACGAGGAGCTCATCATCCTACATAATCGCTTTTTGAAGGCATCCGTTGATGCCATGCGCTTG
AGCACCGATCGATCAAACGCTGAAGATTTGCACACGTGGCGCTACATGGAAATGGCTCCGCGCCATTCTGCGCTC
AATGTCCTGAGCATAGCCGAAATCCTCAGCGACACAGACCTCGCCGTTATAACTAAACTCTTTCCTGCATACAAT
TACATTAAGACGATTGAAGATGACCAAGAAGTCGCAGAATCTCATAATGACATGGCGCCTTATCAAGCCGTTGAA
TCTGAATTACCTGAAATGCCTCTGGACGAGGTTGAATCAGAAGAAGCCGACCAAATCCTGGAAACTAAGCAGCGT
GGTGGAAGTCTGCATCTACTCAAGAAGGAACTTTCCATTTTCGACCGGCTGGAGAATGTCGACATCTCCCAACTC
CCCGAGTCTGAGCGCCTTGAACTACAGCGGCGGCTCGAACGCAATTCAATTGAAGCGGCAATTGCCAAGTGGCGA
GTAACCAATAATCAGCTTCTCAAGATGGGCAAAGTCTCAGCTCTAGGAACTTCTTCAAACAACCGCCTCTCTAGA
CTCATCTCCAAGTGGTTTTACGCCATGGAGAAACAGCTTGTCGAAGAACTTGAACTTGTTAAAGTCTCGGAGGAG
CGTTCCAGAAGTTCCTTGGACAGACAACGCTGTCTTTTTGGCCCTCTCCTACAGCAATCTGACCCTGGCCGCCTA
GCTGCCTTGACAATTCTCTGCGTCATAAACAATGGCGCCCTCGCTGGTGTCGACAGGGGATTGGGAGTCAGTAAC
CTTGTCCACACCATCTCTGCCAGAGTTCAGGAAGATATTGAGACACAGAAATTAGAAATGGCAAAGAAGCATCGA
AAGAGGAAACATCTGCTCGAGTACGTCGAGAGAAAGCAAAAGACTAAACCCATAACCCTAGACGAATCGCCCGAG
GTGGAAAAATGGCTCGATGATGAGTCGGCTCCGTTGGACCCAAGCGAAGCTGAACAAAGAGGTCGCTGGTCAAAC
CGAGCCAGAGCTTATACTGGCTCCATTCTCCTCAAGACCCTTGTCGAGACAGCAAAAGTTGATGTAAAGATGCGA
CATCCGCAAACTGGAGAACTCGTTACCCAATCGCAGCCGGCCTTTACTCACATGCAGCGGCCTCGAAAGGGAAAG
AAAATTGGCACCTTGGTCTTCAATCCGGCCGTGACAGAATTACTTCGAAGTGAGCCGATAGGCGATTACCTGGCG
AAGCAGCTGCCCATGATTACCAAACCGAGGCCTTGGACCTCATTTGACAAAGGTGGCTTCTTTTACAGCAAGACT
TCTTTTGTACGTGTCAAACAGGGCGATGAAGAGCAGAGACTGTACACAGAAGCCGCTATCAGGTGTGGGAATATG
CGACAAATCTTCAAAGGACTAGATGTCCTTGGACGAACAGCATGGAAGATTAATGAGCCCTTGCTCAAGGTGATG
ATGGAGGCTTGGAACTCTGGCCAAGGTATTGCAAACATGCCACCCCTCGAGCCAACCGTGCCACAGCCTCCAGAG
CCCCCGACAGATGCGCCGCCACATGAACGCTATCGGTGGATGCGGGCGCTCAAGGTAGTTGAAAACGAAAAGGCA
GGGCTGCACTCGCAGCGCTGCTACATGAATTTGCAGCTTGAAGTTGCACGGGCCTTTCGCAAGCAAACCATTTAT
TTTCCACACAATGTCGACTATCGCGGCAGAACATATCCAATTCCAACCTATCTCAACCACATGGGAGCCGATCAC
ACGCGAGCCGTTCTTGTTTTTGCCGAAAGAAGGAAGCTGGGGACGCGTGGCCTGAAATGGCTCAAGATACATCTC
GCCAACGTGTATGGCCTCGACAAATCGAGTCTATCAGAACGAGAAAAATTCACGGATGAACATACACAAGACATT
ATCGAATCGGCAAGTAATCCTCTCAATGGGCGTCGCTGGTGGCTGAAAGCCGAAGACCCGTGGCAATGCCTAGGA
GCCTGTATGGAGCTCAAGGCGGCACTCGACCTGGCCGACCCAACAGAATTTCTCTCAAGTCTCCCCATCCACCAA
GACGGCACTTGCAACGGCCTGCAGCATTATGCAGCATTGGGTGGCGACTTGTGGGGTGCCAAGCAAGTCAACTTG
GAGCCTGGCGACCGGCCTGCCGATGTCTACTCTGCAGTTGCCGACCTCGTCAAGGCAGACATTGAAAAGGATGCC
GCGGGCGACAACACCTATGCCAAGGTGCTCCAAGGCAAAATCACGCGCAAGGTTGTCAAACAGACTGTCATGACC
AATGTCTATGGCGTGACGTTTGTGGGTGCCAAGAAGCAAGTATGCAAGCAACTGGACGACTTGTATCCCGACCTG
GGAAAGGAATATGGCCTTCCCAACATAGTATTGGCCACATATGTGGCCAAGCTGATTTTTGGCGCCCTCGCCACC
ATGTTCAAGGGTGCACATGATATTCAACACTGGCTGGGCGACATTGGGAGCAGGGTGAGCCGAGCCCTGACGCCT
ACACAGCTCAATCAACTTAGCGATGCATATCGCAAAGGATCCGGTGATGACGAAATGGTGTTGAGAAAGGGCAAG
ATCATCAGGGCTTCTGATTTGAAATCATTCGAGGACCTTGCGGCACAATTCCGGTCAACAATTGTGTGGACGACA
CCTTTGCGAATGCCAGTGGTGCAACCATACCGGAAATGCACCTCTAGGGAGATTCGCACCTGTTTCCAGGCACTC
TCGTTTCCCATACACGGCCATGCCAATATGATCGACCGCAGAAAACAGCTACAGGGATTTCCCCCAAATTTCATC
CACTCACTCGACGCCAGCCACATGCTTTTGTCTGCTTTGAAATGCGACGAGCTTGGTCTCACCTTTGCTGCTGTC
CATGACTCGTTTTGGACCCACGCCGCCGACATTGATGTCATGAATGCTGTGCTTCGCGAAGCTTTTATCAACATT
CATCAAGACGATGTGGTTGGTCGTCTGGCTGACGAATTCAGGACTCGTCACGACGGTTCCATCTATCTGGCAAGA
GTTGAGACGAATTCACCGGCGGGAAAAGAAATCAAGGAGCTTCGGAAGAAGATCAAGAGGTCGGCAGTGGAGGAG
CTGCTGCTCGAACATAAACGCCTCACGCTGATGAGATCATCGGATCCTCTTGACCGCGAAACGGCCAAGCAAATA
ATAACCCCGGCATCTATTTATGAAAAGGCGGAGGAAAAGTCTGACATAGCGGCCATTGAAGATGCCAAGCTCTTA
TCTCTGGGTAAAATTAGTGAGAACGAGAGGGCTGGCGATGAGGGACAAGCAGAATCCGATGAGGAATCGGAATCG
GCCAGTGGCGAGGAGGGATTGGATCTAGAAGCAGAAGCGGATATGGACATGAGTAGTGAGGATATAACGTCGGAC
GCAGTGCACATGATGCAGGAGTTGCTCAGTCGTGCGAGCACGCCATCGTTTGAGTCCCAGCTGCATGGGTACAAC
AAGAAGGCTGTAAAGCCGAAGAAGAAGCCAACTATAAAAGTCTGGCTGCCCCTTACTATTCCGAAGATTCCCGAA
AAGGGTGAATTCGACGTCAAGCGGCTACGTCAAAGCCAATATTTCTTTTCATAG
Gene >OphauG2|4961
ATGGTGCTCTCACGACAAGCTCGCGGCCGCCTTCCTGTGCCTCGCACCACTCCCACTCGGCCATCTCTTTTGCCG
CTCAAAATCTGCACACCAGTCTCTCAACTTCCTTCGCTCTCTCGTCAACATGTTGTTCTGCGCCAGCCCCAGCTC
TGGCCGTACCGCCGACTGGAGTCCGACCCCAGCTCCTTCCTTGTTCACGAACGAGGCATGGCAACGGCTGTCAAT
GACTATAGAGTCGACTCGTCCATGTACAATCCAATCAACTCTCCAGCAATGTCGCCCTTCATCCATTCATCCCTA
TTGGTGCCGTTCGACCCCTCTTCGGTCGTTCATATTCCAGAGGTCTCCCTTCCTGTGCCTACAAGCAAGACCAAC
AAATTCGGCGTCCCAGGAGACGTATTAGACTTACTTCCCATGTTCGACGCCTGCATTCAAGTCAAAAAAATCCAA
CGCGCGGCCGAAGTCCTTAAACGCCTCAGTGGTCTTCCTAATCTCTCCGACGAGGAGCTCATCATCCTACATAAT
CGCTTTTTGAAGGCATCCGTTGATGCCATGCGCTTGAGCACCGATCGATCAAACGCTGAAGATTTGCACACGTGG
TATGAGGTGCAAATTCACGCCAAGGGCCTGCCAATCACGCCTGAAACTCTTGCCTGCATGCTTAAAGTCTCCCTT
TTATCTGAGCGAGGCGCCAGACTCACTCGCCTAGTCAGGCGCTACATGGAAATGGCTCCGCGCCATTCTGCGCTC
AATGTCCTGAGCATAGCCGAAATCCTCAGCGACACAGACCTCGCCGTTATAACTAAACTCTTTCCTGCATACAAT
TACATTAAGACGATTGAAGATGACCAAGAAGTCGCAGAATCTCATAATGACATGGCGCCTTATCAAGCCGTTGAA
TCTGAATTACCTGAAATGCCTCTGGACGAGGTTGAATCAGAAGAAGCCGACCAAATCCTGGAAACTAAGCAGCGT
GGTGGAAGTCTGCATCTACTCAAGAAGGAACTTTCCATTTTCGACCGGCTGGAGAATGTCGACATCTCCCAACTC
CCCGAGTCTGAGCGCCTTGAACTACAGCGGCGGCTCGAACGCAATTCAATTGAAGCGGCAATTGCCAAGTGGCGA
GTAACCAATAATCAGCTTCTCAAGATGGGCAAAGTCTCAGCTCTAGGAACTTCTTCAAACAACCGCCTCTCTAGA
CTCATCTCCAAGTGGTTTTACGCCATGGAGAAACAGCTTGTCGAAGAACTTGAACTTGTTAAAGTCTCGGAGGAG
CGTTCCAGAAGTTCCTTGGACAGACAACGCTGTCTTTTTGGCCCTCTCCTACAGCAATCTGACCCTGGCCGCCTA
GCTGCCTTGACAATTCTCTGCGTCATAAACAATGGCGCCCTCGCTGGTGTCGACAGGGGATTGGGAGTCAGTAAC
CTTGTCCACACCATCTCTGCCAGAGTTCAGGAAGATATTGAGACACAGAAATTAGAAATGGCAAAGAAGCATCGA
AAGAGGAAACATCTGCTCGAGTACGTCGAGAGAAAGCAAAAGACTAAACCCATAACCCTAGACGAATCGCCCGAG
GTGGAAAAATGGCTCGATGATGAGTCGGCTCCGTTGGACCCAAGCGAAGCTGAACAAAGAGGTCGCTGGTCAAAC
CGAGCCAGAGCTTATACTGGCTCCATTCTCCTCAAGACCCTTGTCGAGACAGCAAAAGTTGATGTAAAGATGCGA
CATCCGCAAACTGGAGAACTCGTTACCCAATCGCAGCCGGCCTTTACTCACATGCAGCGGCCTCGAAAGGGAAAG
AAAATTGGCACCTTGGTCTTCAATCCGGCCGTGACAGAATTACTTCGAAGTGAGCCGATAGGCGATTACCTGGCG
AAGCAGCTGCCCATGATTACCAAACCGAGGCCTTGGACCTCATTTGACAAAGGTGGCTTCTTTTACAGCAAGACT
TCTTTTGTACGTGTCAAACAGGGCGATGAAGAGCAGAGACTGTACACAGAAGCCGCTATCAGGTGTGGGAATATG
CGACAAATCTTCAAAGGACTAGATGTCCTTGGACGAACAGCATGGAAGATTAATGAGCCCTTGCTCAAGGTGATG
ATGGAGGCTTGGAACTCTGGCCAAGGTATTGCAAACATGCCACCCCTCGAGCCAACCGTGCCACAGCCTCCAGAG
CCCCCGACAGATGCGCCGCCACATGAACGCTATCGGTGGATGCGGGCGCTCAAGGTAGTTGAAAACGAAAAGGCA
GGGCTGCACTCGCAGCGCTGCTACATGAATTTGCAGCTTGAAGTTGCACGGGCCTTTCGCAAGCAAACCATTTAT
TTTCCACACAATGTCGACTATCGCGGCAGAACATATCCAATTCCAACCTATCTCAACCACATGGGAGCCGATCAC
ACGCGAGCCGTTCTTGTTTTTGCCGAAAGAAGGAAGCTGGGGACGCGTGGCCTGAAATGGCTCAAGATACATCTC
GCCAACGTGTATGGCCTCGACAAATCGAGTCTATCAGAACGAGAAAAATTCACGGATGAACATACACAAGACATT
ATCGAATCGGCAAGTAATCCTCTCAATGGGCGTCGCTGGTGGCTGAAAGCCGAAGACCCGTGGCAATGCCTAGGA
GCCTGTATGGAGCTCAAGGCGGCACTCGACCTGGCCGACCCAACAGAATTTCTCTCAAGTCTCCCCATCCACCAA
GACGGCACTTGCAACGGCCTGCAGCATTATGCAGCATTGGGTGGCGACTTGTGGGGTGCCAAGCAAGTCAACTTG
GAGCCTGGCGACCGGCCTGCCGATGTCTACTCTGCAGTTGCCGACCTCGTCAAGGCAGACATTGAAAAGGATGCC
GCGGGCGACAACACCTATGCCAAGGTGCTCCAAGGCAAAATCACGCGCAAGGTTGTCAAACAGACTGTCATGACC
AATGTCTATGGCGTGACGTTTGTGGGTGCCAAGAAGCAAGTATGCAAGCAACTGGACGACTTGTATCCCGACCTG
GGAAAGGAATATGGCCTTCCCAACATAGTATTGGCCACATATGTGGCCAAGCTGATTTTTGGCGCCCTCGCCACC
ATGTTCAAGGGTGCACATGATATTCAACACTGGCTGGGCGACATTGGGAGCAGGGTGAGCCGAGCCCTGACGCCT
ACACAGCTCAATCAACTTAGCGATGCATATCGCAAAGGATCCGGTGATGACGAAATGGTGTTGAGAAAGGGCAAG
ATCATCAGGGCTTCTGATTTGAAATCATTCGAGGACCTTGCGGCACAATTCCGGTCAACAATTGTGTGGACGACA
CCTTTGCGAATGCCAGTGGTGCAACCATACCGGAAATGCACCTCTAGGGAGATTCGCACCTGTTTCCAGGCACTC
TCGTTTCCCATACACGGCCATGCCAATATGATCGACCGCAGAAAACAGCTACAGGGATTTCCCCCAAATTTCATC
CACTCACTCGACGCCAGCCACATGCTTTTGTCTGCTTTGAAATGCGACGAGCTTGGTCTCACCTTTGCTGCTGTC
CATGACTCGTTTTGGACCCACGCCGCCGACATTGATGTCATGAATGCTGTGCTTCGCGAAGCTTTTATCAACATT
CATCAAGACGATGTGGTTGGTCGTCTGGCTGACGAATTCAGGACTCGTCACGACGGTTCCATCTATCTGGCAAGA
GTTGAGACGAATTCACCGGCGGGAAAAGAAATCAAGGAGCTTCGGAAGAAGATCAAGAGGTCGGCAGTGGAGGAG
CTGCTGCTCGAACATAAACGCCTCACGCTGATGAGATCATCGGATCCTCTTGACCGCGAAACGGCCAAGCAAATA
ATAACCCCGGCATCTATTTATGAAAAGGCGGAGGAAAAGTCTGACATAGCGGCCATTGAAGATGCCAAGCTCTTA
TCTCTGGGTAAAATTAGTGAGAACGAGAGGGCTGGCGATGAGGGACAAGCAGAATCCGATGAGGAATCGGAATCG
GCCAGTGGCGAGGAGGGATTGGATCTAGAAGCAGAAGCGGATATGGACATGAGTAGTGAGGATATAACGTCGGAC
GCAGTGCACATGATGCAGGAGTTGCTCAGTCGTGCGAGCACGCCATCGTTTGAGTCCCAGCTGCATGGGTACAAC
AAGAAGGCTGTAAAGCCGAAGAAGAAGCCAACTATAAAAGTCTGGCTGCCCCTTACTATTCCGAAGATTCCCGAA
AAGGTTGGAACATTTTCTCTTGCTTGCTGGCTTGACTTGGTTTTTTTTTTTTTTAAAAAAAAAAATTTACTAACG
TGTGGGTTGCAGGGTGAATTCGACGTCAAGCGGCTACGTCAAAGCCAATATTTCTTTTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail