Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4958
Gene name
LocationContig_434:12551..14859
Strand+
Gene length (bp)2308
Transcript length (bp)2244
Coding sequence length (bp)2244
Protein length (aa) 748

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01485 IBR IBR domain, a half RING-finger domain 2.7E-14 284 382
PF05773 RWD RWD domain 2.0E-14 9 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 5 467 3.0E-48
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 85 475 2.0E-31
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 85 452 6.0E-31
sp|Q1L8G6|AKIB1_DANRE Ankyrin repeat and IBR domain-containing protein 1 OS=Danio rerio GN=ankib1 PE=3 SV=1 195 438 9.0E-16
sp|Q9P2G1|AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens GN=ANKIB1 PE=1 SV=3 211 438 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 5 467 3.0E-48
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 85 475 2.0E-31
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 85 452 6.0E-31
sp|Q1L8G6|AKIB1_DANRE Ankyrin repeat and IBR domain-containing protein 1 OS=Danio rerio GN=ankib1 PE=3 SV=1 195 438 9.0E-16
sp|Q9P2G1|AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens GN=ANKIB1 PE=1 SV=3 211 438 5.0E-15
sp|Q6ZPS6|AKIB1_MOUSE Ankyrin repeat and IBR domain-containing protein 1 OS=Mus musculus GN=Ankib1 PE=1 SV=2 211 438 5.0E-15
sp|Q04638|ITT1_YEAST Translation termination inhibitor protein ITT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITT1 PE=1 SV=1 95 468 7.0E-15
sp|Q9LVW9|ARI4_ARATH Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana GN=ARI4 PE=5 SV=2 145 438 3.0E-13
sp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7 OS=Arabidopsis thaliana GN=ARI7 PE=2 SV=1 195 443 1.0E-12
sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=4 268 438 7.0E-11
sp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5 OS=Arabidopsis thaliana GN=ARI5 PE=2 SV=1 191 443 9.0E-11
sp|O95376|ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens GN=ARIH2 PE=1 SV=1 194 438 1.0E-10
sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 268 438 1.0E-10
sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=1 SV=1 194 438 1.0E-10
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 178 438 2.0E-10
sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 195 438 2.0E-10
sp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana GN=ARI8 PE=2 SV=1 195 438 5.0E-10
sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 268 438 5.0E-10
sp|Q9SKC2|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11 OS=Arabidopsis thaliana GN=ARI11 PE=2 SV=1 190 454 7.0E-10
sp|Q9LVX0|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1 135 438 7.0E-10
sp|Q54CX4|Y5521_DICDI Uncharacterized protein DDB_G0292642 OS=Dictyostelium discoideum GN=DDB_G0292642 PE=3 SV=2 190 453 1.0E-09
sp|Q22431|ARI2_CAEEL Probable protein ariadne-2 OS=Caenorhabditis elegans GN=T12E12.1 PE=3 SV=2 211 438 1.0E-09
sp|Q84RR2|ARI2_ARATH Probable E3 ubiquitin-protein ligase ARI2 OS=Arabidopsis thaliana GN=ARI2 PE=2 SV=1 197 438 2.0E-09
sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 190 438 3.0E-09
sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 176 438 8.0E-09
sp|Q949V6|ARI1_ARATH Probable E3 ubiquitin-protein ligase ARI1 OS=Arabidopsis thaliana GN=ARI1 PE=2 SV=1 145 438 2.0E-08
sp|P0C8K8|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI6 OS=Arabidopsis thaliana GN=ARI6 PE=5 SV=1 191 443 5.0E-08
sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 211 448 4.0E-07
sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 211 448 7.0E-07
sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 211 448 8.0E-07
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 212 461 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2384
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4958 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2871
Ophiocordyceps camponoti-floridani Ophcf2|04881
Ophiocordyceps camponoti-rufipedis Ophun1|7019
Ophiocordyceps kimflemingae Ophio5|7857
Ophiocordyceps subramaniannii Hirsu2|3345

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4958
MDDAAEDDLRHQELETLEAIFPEIRRLAGHHDPPASGTALVFELELPVKPMEPVTVVFPTAPTQQLHGSPAVQPA
EHEAVDSLRVCHLPPVVLTFTLPNGYPQHQPPQMSLSTTPQWLSPSTLRHLENDSPGLWEEAGRDLVVYTFIDTV
QRAADQVFGTVTDGKLQVPPEHKLAILDYDIKAKRAAFEEKTFHCGICIEPKRGSSCHEMLDCGHVFCLECLGAF
YNDAIAQGNLSTVRCLQPNCARDRGAVMAKSTSSRPRKPKLYVTPSELLQIGLSEETVKRYIALKYKTQLESDKN
TVYCPRSWCNGAARSDRRKKPQGLELAEPSDEEDEAPGPQQNADHANAPKFESSELLAICEDCSFAFCRRCLQTW
HGKFVRCVSKRDKGELSAEEKASLEYLKLHTSPCPTCDAPAQKTQGCNHMICSRCETHFCYLCCAWLDPTNPYRH
YNTLADGSTTSCYMRLWELEGGDGDDVGQGFAGRQRHVEHVDDDEVDAGFVRQHQGVLVQPGRPGNGQQARARAA
QPANRAGGRVAIEREAPLVLRVRQDAAQQDAQQGEEEGDDDDDALAHLAHIIGLMDGDHELGLGEGQAQMGMEQR
AGQGNRRRAAPANERTAAQNADRRRRGQGNERRAAAQDAGRRTARGRPRPAEPAAQARGAARAPRGQAQPGAREA
APAPVERRPARLDAAPGDGQARGDYLNMAQRDWVQAFVRLALVDAEDELEPDDLDSDDENWLIPDNSDSDDE*
Coding >OphauG2|4958
ATGGACGACGCTGCAGAAGACGACTTGCGGCACCAAGAACTCGAGACGCTCGAGGCCATCTTCCCCGAGATCAGG
CGCCTTGCTGGACACCATGACCCGCCAGCCTCGGGCACCGCCTTGGTCTTTGAGCTGGAGCTGCCCGTCAAGCCC
ATGGAGCCCGTCACGGTGGTATTCCCTACTGCTCCGACGCAACAGCTCCACGGCTCTCCAGCGGTGCAGCCCGCC
GAGCACGAGGCTGTCGACTCGCTGCGGGTTTGCCACTTGCCTCCGGTCGTGCTCACATTTACCCTCCCGAATGGC
TATCCCCAGCATCAGCCACCGCAAATGTCGCTGTCGACGACGCCACAGTGGCTCTCGCCCAGCACGCTCCGACAC
CTCGAAAACGACAGTCCTGGGCTCTGGGAAGAGGCTGGCCGCGACCTCGTCGTCTACACCTTTATCGACACCGTC
CAGCGCGCAGCCGACCAAGTCTTTGGCACTGTGACAGACGGCAAGCTTCAGGTGCCTCCCGAGCACAAGCTGGCC
ATTCTCGACTACGACATCAAGGCAAAGCGAGCTGCCTTTGAAGAAAAGACGTTTCACTGCGGCATATGTATCGAA
CCCAAACGAGGCTCCAGTTGTCACGAGATGCTCGACTGTGGCCATGTCTTTTGCCTCGAGTGTCTTGGCGCCTTT
TACAATGACGCCATTGCCCAAGGAAATCTGTCCACGGTGCGATGCTTGCAACCCAACTGCGCTCGAGACCGGGGG
GCCGTCATGGCAAAGTCGACGTCGAGTCGGCCCCGCAAGCCCAAACTCTACGTGACTCCCAGCGAGTTGCTACAG
ATTGGCCTGTCGGAGGAAACGGTCAAGCGCTACATTGCGCTCAAATACAAGACTCAGCTCGAGTCGGACAAGAAC
ACGGTCTACTGCCCTCGCAGCTGGTGCAACGGAGCAGCTCGATCAGACAGGCGCAAGAAGCCTCAGGGCCTGGAG
CTGGCAGAGCCATCAGACGAGGAAGACGAAGCCCCAGGGCCGCAACAGAATGCTGACCATGCAAATGCGCCCAAG
TTTGAGTCCAGCGAGCTGCTGGCCATCTGCGAAGACTGCAGCTTCGCCTTTTGCCGCCGCTGTCTCCAGACATGG
CACGGCAAATTCGTACGCTGTGTATCCAAGCGGGACAAGGGCGAGCTGAGCGCCGAGGAAAAGGCGTCGCTTGAA
TATCTCAAGCTGCATACCAGCCCGTGTCCGACGTGCGACGCGCCCGCCCAAAAGACACAGGGCTGCAACCACATG
ATTTGCTCGCGCTGCGAGACACATTTCTGCTATCTCTGCTGTGCCTGGCTCGACCCAACCAATCCCTACCGCCAC
TACAACACGCTGGCTGACGGGTCGACTACATCGTGCTACATGCGACTTTGGGAGCTTGAAGGCGGCGACGGCGAC
GACGTGGGCCAGGGCTTTGCCGGCAGACAGCGCCATGTTGAACACGTGGACGACGATGAGGTTGATGCGGGCTTT
GTTAGGCAACACCAAGGCGTACTAGTCCAGCCGGGGCGCCCAGGAAACGGGCAACAGGCTCGGGCTCGGGCGGCA
CAGCCAGCAAATCGAGCAGGAGGACGAGTTGCCATTGAACGAGAAGCACCGCTTGTGTTGCGGGTTAGACAAGAC
GCTGCGCAGCAAGACGCTCAACAGGGAGAAGAAGAAGGCGACGACGATGACGACGCCCTTGCTCATTTAGCGCAC
ATTATCGGATTAATGGATGGGGACCATGAACTAGGTCTAGGCGAGGGGCAAGCACAAATGGGCATGGAGCAGCGA
GCAGGTCAAGGAAATAGAAGGAGAGCAGCCCCAGCCAACGAAAGAACAGCAGCTCAAAACGCCGACAGGAGAAGA
AGAGGTCAAGGAAACGAGAGGAGAGCTGCAGCTCAAGACGCCGGCAGGAGAACGGCACGAGGCAGACCAAGGCCT
GCGGAACCTGCTGCACAAGCCAGAGGGGCAGCTCGGGCGCCAAGGGGCCAGGCTCAGCCAGGAGCAAGGGAAGCG
GCTCCGGCACCAGTTGAGAGACGACCAGCCAGACTTGATGCAGCGCCAGGCGATGGACAAGCTCGGGGGGATTAT
CTCAACATGGCACAGCGTGACTGGGTCCAGGCCTTTGTACGATTGGCGCTTGTGGATGCCGAGGACGAGCTCGAG
CCGGATGACCTCGACTCGGACGATGAAAATTGGCTGATACCGGACAATTCGGATTCAGATGATGAATGA
Transcript >OphauG2|4958
ATGGACGACGCTGCAGAAGACGACTTGCGGCACCAAGAACTCGAGACGCTCGAGGCCATCTTCCCCGAGATCAGG
CGCCTTGCTGGACACCATGACCCGCCAGCCTCGGGCACCGCCTTGGTCTTTGAGCTGGAGCTGCCCGTCAAGCCC
ATGGAGCCCGTCACGGTGGTATTCCCTACTGCTCCGACGCAACAGCTCCACGGCTCTCCAGCGGTGCAGCCCGCC
GAGCACGAGGCTGTCGACTCGCTGCGGGTTTGCCACTTGCCTCCGGTCGTGCTCACATTTACCCTCCCGAATGGC
TATCCCCAGCATCAGCCACCGCAAATGTCGCTGTCGACGACGCCACAGTGGCTCTCGCCCAGCACGCTCCGACAC
CTCGAAAACGACAGTCCTGGGCTCTGGGAAGAGGCTGGCCGCGACCTCGTCGTCTACACCTTTATCGACACCGTC
CAGCGCGCAGCCGACCAAGTCTTTGGCACTGTGACAGACGGCAAGCTTCAGGTGCCTCCCGAGCACAAGCTGGCC
ATTCTCGACTACGACATCAAGGCAAAGCGAGCTGCCTTTGAAGAAAAGACGTTTCACTGCGGCATATGTATCGAA
CCCAAACGAGGCTCCAGTTGTCACGAGATGCTCGACTGTGGCCATGTCTTTTGCCTCGAGTGTCTTGGCGCCTTT
TACAATGACGCCATTGCCCAAGGAAATCTGTCCACGGTGCGATGCTTGCAACCCAACTGCGCTCGAGACCGGGGG
GCCGTCATGGCAAAGTCGACGTCGAGTCGGCCCCGCAAGCCCAAACTCTACGTGACTCCCAGCGAGTTGCTACAG
ATTGGCCTGTCGGAGGAAACGGTCAAGCGCTACATTGCGCTCAAATACAAGACTCAGCTCGAGTCGGACAAGAAC
ACGGTCTACTGCCCTCGCAGCTGGTGCAACGGAGCAGCTCGATCAGACAGGCGCAAGAAGCCTCAGGGCCTGGAG
CTGGCAGAGCCATCAGACGAGGAAGACGAAGCCCCAGGGCCGCAACAGAATGCTGACCATGCAAATGCGCCCAAG
TTTGAGTCCAGCGAGCTGCTGGCCATCTGCGAAGACTGCAGCTTCGCCTTTTGCCGCCGCTGTCTCCAGACATGG
CACGGCAAATTCGTACGCTGTGTATCCAAGCGGGACAAGGGCGAGCTGAGCGCCGAGGAAAAGGCGTCGCTTGAA
TATCTCAAGCTGCATACCAGCCCGTGTCCGACGTGCGACGCGCCCGCCCAAAAGACACAGGGCTGCAACCACATG
ATTTGCTCGCGCTGCGAGACACATTTCTGCTATCTCTGCTGTGCCTGGCTCGACCCAACCAATCCCTACCGCCAC
TACAACACGCTGGCTGACGGGTCGACTACATCGTGCTACATGCGACTTTGGGAGCTTGAAGGCGGCGACGGCGAC
GACGTGGGCCAGGGCTTTGCCGGCAGACAGCGCCATGTTGAACACGTGGACGACGATGAGGTTGATGCGGGCTTT
GTTAGGCAACACCAAGGCGTACTAGTCCAGCCGGGGCGCCCAGGAAACGGGCAACAGGCTCGGGCTCGGGCGGCA
CAGCCAGCAAATCGAGCAGGAGGACGAGTTGCCATTGAACGAGAAGCACCGCTTGTGTTGCGGGTTAGACAAGAC
GCTGCGCAGCAAGACGCTCAACAGGGAGAAGAAGAAGGCGACGACGATGACGACGCCCTTGCTCATTTAGCGCAC
ATTATCGGATTAATGGATGGGGACCATGAACTAGGTCTAGGCGAGGGGCAAGCACAAATGGGCATGGAGCAGCGA
GCAGGTCAAGGAAATAGAAGGAGAGCAGCCCCAGCCAACGAAAGAACAGCAGCTCAAAACGCCGACAGGAGAAGA
AGAGGTCAAGGAAACGAGAGGAGAGCTGCAGCTCAAGACGCCGGCAGGAGAACGGCACGAGGCAGACCAAGGCCT
GCGGAACCTGCTGCACAAGCCAGAGGGGCAGCTCGGGCGCCAAGGGGCCAGGCTCAGCCAGGAGCAAGGGAAGCG
GCTCCGGCACCAGTTGAGAGACGACCAGCCAGACTTGATGCAGCGCCAGGCGATGGACAAGCTCGGGGGGATTAT
CTCAACATGGCACAGCGTGACTGGGTCCAGGCCTTTGTACGATTGGCGCTTGTGGATGCCGAGGACGAGCTCGAG
CCGGATGACCTCGACTCGGACGATGAAAATTGGCTGATACCGGACAATTCGGATTCAGATGATGAATGA
Gene >OphauG2|4958
ATGGACGACGCTGCAGAAGACGACTTGCGGCACCAAGAACTCGAGACGCTCGAGGCCATCTTCCCCGAGATCAGG
CGCCTTGCTGGACACCATGACCCGCCAGCCTCGGGCACCGCCTTGGTCTTTGAGCTGGAGCTGCCCGTCAAGCCC
ATGGAGCCCGTCACGGTGGTATTCCCTACTGCTCCGACGCAACAGCTCCACGGCTCTCCAGCGGTGCAGCCCGCC
GAGCACGAGGCTGTCGACTCGCTGCGGGTTTGCCACTTGCCTCCGGTCGTGCTCACATTTACCCTCCCGAATGGC
TATCCCCAGCATCAGCCACCGCAAATGTCGCTGTCGACGACGCCACAGTGGCTCTCGCCCAGCACGCTCCGACAC
CTCGAAAACGACAGTCCTGGGCTCTGGGAAGAGGCTGGCCGCGACCTCGTCGTCTACACCTTTATCGACACCGTC
CAGCGCGCAGCCGACCAAGTCTTTGGCACTGTGACAGACGGCAAGCTTCAGGTGCCTCCCGAGCACAAGCTGGCC
ATTCTCGACTACGACATCAAGGCAAAGCGAGCTGCCTTTGAAGAAAAGACGTTTCACTGCGGCATATGTATCGGT
AAGTGGCCTGTCCTGTCCCGAGCAATGCTAGCTTGCTTGACTGCTGACTCGCCTCGCTCCAGAACCCAAACGAGG
CTCCAGTTGTCACGAGATGCTCGACTGTGGCCATGTCTTTTGCCTCGAGTGTCTTGGCGCCTTTTACAATGACGC
CATTGCCCAAGGAAATCTGTCCACGGTGCGATGCTTGCAACCCAACTGCGCTCGAGACCGGGGGGCCGTCATGGC
AAAGTCGACGTCGAGTCGGCCCCGCAAGCCCAAACTCTACGTGACTCCCAGCGAGTTGCTACAGATTGGCCTGTC
GGAGGAAACGGTCAAGCGCTACATTGCGCTCAAATACAAGACTCAGCTCGAGTCGGACAAGAACACGGTCTACTG
CCCTCGCAGCTGGTGCAACGGAGCAGCTCGATCAGACAGGCGCAAGAAGCCTCAGGGCCTGGAGCTGGCAGAGCC
ATCAGACGAGGAAGACGAAGCCCCAGGGCCGCAACAGAATGCTGACCATGCAAATGCGCCCAAGTTTGAGTCCAG
CGAGCTGCTGGCCATCTGCGAAGACTGCAGCTTCGCCTTTTGCCGCCGCTGTCTCCAGACATGGCACGGCAAATT
CGTACGCTGTGTATCCAAGCGGGACAAGGGCGAGCTGAGCGCCGAGGAAAAGGCGTCGCTTGAATATCTCAAGCT
GCATACCAGCCCGTGTCCGACGTGCGACGCGCCCGCCCAAAAGACACAGGGCTGCAACCACATGATTTGCTCGCG
CTGCGAGACACATTTCTGCTATCTCTGCTGTGCCTGGCTCGACCCAACCAATCCCTACCGCCACTACAACACGCT
GGCTGACGGGTCGACTACATCGTGCTACATGCGACTTTGGGAGCTTGAAGGCGGCGACGGCGACGACGTGGGCCA
GGGCTTTGCCGGCAGACAGCGCCATGTTGAACACGTGGACGACGATGAGGTTGATGCGGGCTTTGTTAGGCAACA
CCAAGGCGTACTAGTCCAGCCGGGGCGCCCAGGAAACGGGCAACAGGCTCGGGCTCGGGCGGCACAGCCAGCAAA
TCGAGCAGGAGGACGAGTTGCCATTGAACGAGAAGCACCGCTTGTGTTGCGGGTTAGACAAGACGCTGCGCAGCA
AGACGCTCAACAGGGAGAAGAAGAAGGCGACGACGATGACGACGCCCTTGCTCATTTAGCGCACATTATCGGATT
AATGGATGGGGACCATGAACTAGGTCTAGGCGAGGGGCAAGCACAAATGGGCATGGAGCAGCGAGCAGGTCAAGG
AAATAGAAGGAGAGCAGCCCCAGCCAACGAAAGAACAGCAGCTCAAAACGCCGACAGGAGAAGAAGAGGTCAAGG
AAACGAGAGGAGAGCTGCAGCTCAAGACGCCGGCAGGAGAACGGCACGAGGCAGACCAAGGCCTGCGGAACCTGC
TGCACAAGCCAGAGGGGCAGCTCGGGCGCCAAGGGGCCAGGCTCAGCCAGGAGCAAGGGAAGCGGCTCCGGCACC
AGTTGAGAGACGACCAGCCAGACTTGATGCAGCGCCAGGCGATGGACAAGCTCGGGGGGATTATCTCAACATGGC
ACAGCGTGACTGGGTCCAGGCCTTTGTACGATTGGCGCTTGTGGATGCCGAGGACGAGCTCGAGCCGGATGACCT
CGACTCGGACGATGAAAATTGGCTGATACCGGACAATTCGGATTCAGATGATGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail