Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4956
Gene name
LocationContig_434:9719..10886
Strand-
Gene length (bp)1167
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02958 EcKL Ecdysteroid kinase-like family 2.0E-14 41 286
PF01636 APH Phosphotransferase enzyme family 2.1E-13 49 278

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4956
MTPPEHIAHNLLTQVHLRLVSCTELQSLWADYGHICAIEARDAADKRVPLILKLISPPSASRQEEGHLRKVLSYQ
VEQYFYTHIAPRLPPDVPVATCLASTQHQHETAMLLTDLRPRFPLAAGKRELLSPRQVDAVVDWLAIFHASSAAF
FVPASPHAFVLPPLQEAERKTTTRGLWLNGGYTYLATRRSEYASLAADEQSEWSAAFCSPFDAGSEASVAELAAT
FLTPCGRSFESLIHGDVKSENLFSTTQGDAVALFDFQYVGLGLGVCDLAKLFTCSVPPELLHVSPAASFNELPMS
QGEEALLKVYLDTFASRHQPPIDYDWNDFVRHWETALVDWCRFQASWGFWGNTDWLQARVRLILKDNGWRDWIRQ
QAQQSNTKNKAQV*
Coding >OphauG2|4956
ATGACCCCCCCCGAACACATCGCCCATAATCTCCTCACCCAAGTCCACCTCCGGCTGGTGTCGTGCACTGAGCTG
CAGTCGCTATGGGCAGACTATGGCCACATCTGTGCCATTGAGGCTCGCGATGCCGCCGACAAGCGCGTGCCGCTC
ATCCTCAAGCTCATTTCGCCCCCCAGCGCTTCCCGCCAAGAAGAAGGCCATTTGCGCAAAGTCCTGAGCTACCAA
GTCGAGCAGTACTTCTACACCCACATAGCGCCACGCTTGCCCCCAGACGTGCCCGTGGCGACGTGTCTCGCCTCT
ACACAGCACCAGCACGAGACGGCCATGCTGCTCACAGACCTGAGGCCTCGGTTTCCTCTTGCAGCCGGCAAGAGG
GAGCTGCTATCGCCGCGCCAAGTCGACGCCGTTGTCGACTGGCTGGCCATTTTCCATGCCAGCTCTGCTGCTTTC
TTTGTGCCTGCCAGCCCCCATGCCTTTGTCCTGCCGCCGCTCCAAGAGGCTGAGCGCAAGACAACCACGCGCGGA
CTCTGGCTCAACGGCGGCTACACATATCTCGCCACGCGAAGGTCCGAGTACGCTTCATTGGCCGCAGACGAGCAG
TCAGAGTGGTCCGCTGCCTTTTGCAGCCCCTTTGACGCCGGCTCCGAGGCCTCAGTCGCCGAGCTGGCGGCCACC
TTTCTCACCCCTTGCGGCCGGTCCTTTGAGTCGCTGATTCACGGAGACGTCAAGTCGGAAAACCTCTTCTCTACT
ACTCAAGGAGATGCCGTAGCTCTCTTTGACTTTCAGTATGTAGGGCTCGGGCTCGGCGTCTGCGATCTCGCAAAG
CTCTTTACCTGCTCTGTCCCTCCTGAATTGCTCCATGTCTCGCCCGCAGCCAGCTTCAACGAGCTACCCATGAGC
CAGGGCGAAGAGGCACTGCTCAAGGTTTATCTTGACACCTTTGCCAGCCGTCACCAACCCCCGATTGACTACGAT
TGGAATGACTTTGTGCGTCACTGGGAAACTGCGCTGGTTGACTGGTGCCGCTTCCAGGCCTCGTGGGGCTTCTGG
GGCAACACGGACTGGCTTCAGGCCCGAGTCAGACTGATTCTCAAGGATAACGGCTGGCGTGACTGGATCAGGCAG
CAAGCACAACAAAGCAACACCAAGAACAAGGCTCAAGTCTGA
Transcript >OphauG2|4956
ATGACCCCCCCCGAACACATCGCCCATAATCTCCTCACCCAAGTCCACCTCCGGCTGGTGTCGTGCACTGAGCTG
CAGTCGCTATGGGCAGACTATGGCCACATCTGTGCCATTGAGGCTCGCGATGCCGCCGACAAGCGCGTGCCGCTC
ATCCTCAAGCTCATTTCGCCCCCCAGCGCTTCCCGCCAAGAAGAAGGCCATTTGCGCAAAGTCCTGAGCTACCAA
GTCGAGCAGTACTTCTACACCCACATAGCGCCACGCTTGCCCCCAGACGTGCCCGTGGCGACGTGTCTCGCCTCT
ACACAGCACCAGCACGAGACGGCCATGCTGCTCACAGACCTGAGGCCTCGGTTTCCTCTTGCAGCCGGCAAGAGG
GAGCTGCTATCGCCGCGCCAAGTCGACGCCGTTGTCGACTGGCTGGCCATTTTCCATGCCAGCTCTGCTGCTTTC
TTTGTGCCTGCCAGCCCCCATGCCTTTGTCCTGCCGCCGCTCCAAGAGGCTGAGCGCAAGACAACCACGCGCGGA
CTCTGGCTCAACGGCGGCTACACATATCTCGCCACGCGAAGGTCCGAGTACGCTTCATTGGCCGCAGACGAGCAG
TCAGAGTGGTCCGCTGCCTTTTGCAGCCCCTTTGACGCCGGCTCCGAGGCCTCAGTCGCCGAGCTGGCGGCCACC
TTTCTCACCCCTTGCGGCCGGTCCTTTGAGTCGCTGATTCACGGAGACGTCAAGTCGGAAAACCTCTTCTCTACT
ACTCAAGGAGATGCCGTAGCTCTCTTTGACTTTCAGTATGTAGGGCTCGGGCTCGGCGTCTGCGATCTCGCAAAG
CTCTTTACCTGCTCTGTCCCTCCTGAATTGCTCCATGTCTCGCCCGCAGCCAGCTTCAACGAGCTACCCATGAGC
CAGGGCGAAGAGGCACTGCTCAAGGTTTATCTTGACACCTTTGCCAGCCGTCACCAACCCCCGATTGACTACGAT
TGGAATGACTTTGTGCGTCACTGGGAAACTGCGCTGGTTGACTGGTGCCGCTTCCAGGCCTCGTGGGGCTTCTGG
GGCAACACGGACTGGCTTCAGGCCCGAGTCAGACTGATTCTCAAGGATAACGGCTGGCGTGACTGGATCAGGCAG
CAAGCACAACAAAGCAACACCAAGAACAAGGCTCAAGTCTGA
Gene >OphauG2|4956
ATGACCCCCCCCGAACACATCGCCCATAATCTCCTCACCCAAGTCCACCTCCGGCTGGTGTCGTGCACTGAGCTG
CAGTCGCTATGGGCAGACTATGGCCACATCTGTGCCATTGAGGCTCGCGATGCCGCCGACAAGCGCGTGCCGCTC
ATCCTCAAGCTCATTTCGCCCCCCAGCGCTTCCCGCCAAGAAGAAGGCCATTTGCGCAAAGTCCTGAGCTACCAA
GTCGAGCAGTACTTCTACACCCACATAGCGCCACGCTTGCCCCCAGACGTGCCCGTGGCGACGTGTCTCGCCTCT
ACACAGCACCAGCACGAGACGGCCATGCTGCTCACAGACCTGAGGCCTCGGTTTCCTCTTGCAGCCGGCAAGAGG
GAGCTGCTATCGCCGCGCCAAGTCGACGCCGTTGTCGACTGGCTGGCCATTTTCCATGCCAGCTCTGCTGCTTTC
TTTGTGCCTGCCAGCCCCCATGCCTTTGTCCTGCCGCCGCTCCAAGAGGCTGAGCGCAAGACAACCACGCGCGGA
CTCTGGCTCAACGGCGGCTACACATATCTCGCCACGCGAAGGTCCGAGTACGCTTCATTGGCCGCAGACGAGCAG
TCAGAGTGGTCCGCTGCCTTTTGCAGCCCCTTTGACGCCGGCTCCGAGGCCTCAGTCGCCGAGCTGGCGGCCACC
TTTCTCACCCCTTGCGGCCGGTCCTTTGAGTCGCTGATTCACGGAGACGTCAAGTCGGAAAACCTCTTCTCTACT
ACTCAAGGAGATGCCGTAGCTCTCTTTGACTTTCAGTATGTAGGGCTCGGGCTCGGCGTCTGCGATCTCGCAAAG
CTCTTTACCTGCTCTGTCCCTCCTGAATTGCTCCATGTCTCGCCCGCAGCCAGCTTCAACGAGCTACCCATGAGC
CAGGGCGAAGAGGCACTGCTCAAGGTTTATCTTGACACCTTTGCCAGCCGTCACCAACCCCCGATTGACTACGAT
TGGAATGACTTTGTGCGTCACTGGGAAACTGCGCTGGTTGACTGGTGCCGCTTCCAGGCCTCGTGGGGCTTCTGG
GGCAACACGGACTGGCTTCAGGCCCGAGTCAGACTGATTCTCAAGGATAACGGCTGGCGTGACTGGATCAGGCAG
CAAGCACAACAAAGCAACACCAAGAACAAGGCTCAAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail