Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4932
Gene name
LocationContig_43:43282..43896
Strand+
Gene length (bp)614
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain 2.6E-18 111 176
PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain 2.2E-13 44 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53163|MNP1_YEAST 54S ribosomal protein L12, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNP1 PE=1 SV=1 37 178 9.0E-35
sp|Q9USJ9|MNP1_SCHPO 54S ribosomal protein L12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl12 PE=3 SV=2 8 178 1.0E-31
sp|Q7YR75|RM12_BOVIN 39S ribosomal protein L12, mitochondrial OS=Bos taurus GN=MRPL12 PE=1 SV=1 8 178 7.0E-23
sp|Q9DB15|RM12_MOUSE 39S ribosomal protein L12, mitochondrial OS=Mus musculus GN=Mrpl12 PE=1 SV=2 43 178 5.0E-21
sp|P52815|RM12_HUMAN 39S ribosomal protein L12, mitochondrial OS=Homo sapiens GN=MRPL12 PE=1 SV=2 43 178 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53163|MNP1_YEAST 54S ribosomal protein L12, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNP1 PE=1 SV=1 37 178 9.0E-35
sp|Q9USJ9|MNP1_SCHPO 54S ribosomal protein L12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl12 PE=3 SV=2 8 178 1.0E-31
sp|Q7YR75|RM12_BOVIN 39S ribosomal protein L12, mitochondrial OS=Bos taurus GN=MRPL12 PE=1 SV=1 8 178 7.0E-23
sp|Q9DB15|RM12_MOUSE 39S ribosomal protein L12, mitochondrial OS=Mus musculus GN=Mrpl12 PE=1 SV=2 43 178 5.0E-21
sp|P52815|RM12_HUMAN 39S ribosomal protein L12, mitochondrial OS=Homo sapiens GN=MRPL12 PE=1 SV=2 43 178 2.0E-20
sp|P52827|RM12_CRICR 39S ribosomal protein L12, mitochondrial OS=Cricetus cricetus GN=MRPL12 PE=2 SV=1 43 178 1.0E-19
sp|O78414|RK12_GUITH 50S ribosomal protein L12, chloroplastic OS=Guillardia theta GN=rpl12 PE=3 SV=1 44 162 5.0E-15
sp|B3EER1|RL7_CHLL2 50S ribosomal protein L7/L12 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rplL PE=3 SV=1 45 175 1.0E-14
sp|Q6B905|RK12_GRATL 50S ribosomal protein L12, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl12 PE=3 SV=1 42 175 2.0E-14
sp|Q1XDE8|RK12_PYRYE 50S ribosomal protein L12, chloroplastic OS=Pyropia yezoensis GN=rpl12 PE=3 SV=1 44 177 2.0E-14
sp|C3LR59|RL7_VIBCM 50S ribosomal protein L7/L12 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplL PE=3 SV=1 47 175 1.0E-13
sp|Q9KV31|RL7_VIBCH 50S ribosomal protein L7/L12 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplL PE=3 SV=1 47 175 1.0E-13
sp|A5F3P4|RL7_VIBC3 50S ribosomal protein L7/L12 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplL PE=3 SV=1 47 175 1.0E-13
sp|A7HCH8|RL7_ANADF 50S ribosomal protein L7/L12 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplL PE=3 SV=1 48 175 3.0E-13
sp|Q9ZE21|RL7_RICPR 50S ribosomal protein L7/L12 OS=Rickettsia prowazekii (strain Madrid E) GN=rplL PE=3 SV=1 45 175 8.0E-13
sp|A2C031|RL7_PROM1 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain NATL1A) GN=rplL PE=3 SV=1 107 177 2.0E-12
sp|B2S2I7|RL7_TREPS 50S ribosomal protein L7/L12 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rplL PE=3 SV=1 47 175 4.0E-12
sp|O83268|RL7_TREPA 50S ribosomal protein L7/L12 OS=Treponema pallidum (strain Nichols) GN=rplL PE=3 SV=1 47 175 4.0E-12
sp|Q7VDY8|RL7_PROMA 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplL PE=3 SV=1 108 177 5.0E-12
sp|Q68XM9|RL7_RICTY 50S ribosomal protein L7/L12 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplL PE=3 SV=1 45 175 6.0E-12
sp|Q1D7U4|RL7_MYXXD 50S ribosomal protein L7/L12 OS=Myxococcus xanthus (strain DK 1622) GN=rplL PE=3 SV=1 48 175 7.0E-12
sp|Q20F00|RK12_OLTVI 50S ribosomal protein L12, chloroplastic OS=Oltmannsiellopsis viridis GN=rpl12 PE=3 SV=1 46 175 8.0E-12
sp|P51339|RK12_PORPU 50S ribosomal protein L12, chloroplastic OS=Porphyra purpurea GN=rpl12 PE=3 SV=1 44 175 9.0E-12
sp|Q46HH2|RL7_PROMT 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain NATL2A) GN=rplL PE=3 SV=1 107 177 1.0E-11
sp|A9BDG4|RL7_PROM4 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplL PE=3 SV=1 108 177 1.0E-11
sp|Q3ZJ41|RK12_PSEAK 50S ribosomal protein L12, chloroplastic OS=Pseudendoclonium akinetum GN=rpl12 PE=3 SV=1 45 175 2.0E-11
sp|P49550|RK12_ODOSI 50S ribosomal protein L12, chloroplastic OS=Odontella sinensis GN=rpl12 PE=3 SV=1 42 163 2.0E-11
sp|B3PM75|RL7_MYCA5 50S ribosomal protein L7/L12 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rplL PE=3 SV=1 58 178 3.0E-11
sp|P41189|RL7_LIBAF 50S ribosomal protein L7/L12 OS=Liberibacter africanus GN=rplL PE=3 SV=1 45 177 4.0E-11
sp|Q0I6L0|RL7_SYNS3 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain CC9311) GN=rplL PE=3 SV=1 107 177 4.0E-11
sp|Q9TL30|RK12_NEPOL 50S ribosomal protein L12, chloroplastic OS=Nephroselmis olivacea GN=rpl12 PE=3 SV=1 38 175 5.0E-11
sp|Q31CY0|RL7_PROM9 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplL PE=3 SV=1 107 177 7.0E-11
sp|Q492B8|RL7_BLOPB 50S ribosomal protein L7/L12 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplL PE=3 SV=1 47 175 7.0E-11
sp|A5GPD2|RL7_SYNPW 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain WH7803) GN=rplL PE=3 SV=1 42 177 8.0E-11
sp|Q8CTT1|RL7_STAES 50S ribosomal protein L7/L12 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplL PE=3 SV=1 47 175 8.0E-11
sp|Q5HRL2|RL7_STAEQ 50S ribosomal protein L7/L12 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplL PE=3 SV=1 47 175 8.0E-11
sp|A8G2K8|RL7_PROM2 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplL PE=3 SV=1 107 177 9.0E-11
sp|A2BNZ6|RL7_PROMS 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain AS9601) GN=rplL PE=3 SV=1 107 177 1.0E-10
sp|A3PAR9|RL7_PROM0 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplL PE=3 SV=1 107 177 1.0E-10
sp|Q4L3K1|RL7_STAHJ 50S ribosomal protein L7/L12 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplL PE=3 SV=1 47 175 1.0E-10
sp|Q49V50|RL7_STAS1 50S ribosomal protein L7/L12 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplL PE=3 SV=1 47 175 1.0E-10
sp|Q7V384|RL7_PROMP 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplL PE=3 SV=1 107 177 1.0E-10
sp|A8ZV50|RL7_DESOH 50S ribosomal protein L7/L12 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplL PE=3 SV=1 48 175 1.0E-10
sp|A2BUH8|RL7_PROM5 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplL PE=3 SV=1 107 177 1.0E-10
sp|A8MLD1|RL7_ALKOO 50S ribosomal protein L7/L12 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplL PE=3 SV=1 45 177 1.0E-10
sp|Q2II87|RL7_ANADE 50S ribosomal protein L7/L12 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplL PE=3 SV=1 48 175 2.0E-10
sp|Q6MJ06|RL7_BDEBA 50S ribosomal protein L7/L12 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplL PE=3 SV=1 47 177 2.0E-10
sp|A0T0C0|RK12_PHATC 50S ribosomal protein L12, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl12 PE=3 SV=1 42 173 2.0E-10
sp|B4S496|RL7_PROA2 50S ribosomal protein L7/L12 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplL PE=3 SV=1 45 175 2.0E-10
sp|B0CAD2|RL7_ACAM1 50S ribosomal protein L7/L12 OS=Acaryochloris marina (strain MBIC 11017) GN=rplL PE=3 SV=1 47 173 3.0E-10
sp|P31915|RK12_EUGGR 50S ribosomal protein L12, chloroplastic OS=Euglena gracilis GN=rpl12 PE=3 SV=1 47 177 3.0E-10
sp|Q2JM48|RL7_SYNJB 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplL PE=3 SV=1 42 175 3.0E-10
sp|Q6GJC8|RL7_STAAR 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain MRSA252) GN=rplL PE=3 SV=1 47 175 5.0E-10
sp|A6QEJ2|RL7_STAAE 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain Newman) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|P66062|RL7_STAAW 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain MW2) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|A8YZN8|RL7_STAAT 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|Q6GBU7|RL7_STAAS 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain MSSA476) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|P99154|RL7_STAAN 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain N315) GN=rplL PE=1 SV=1 107 175 6.0E-10
sp|P66061|RL7_STAAM 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|Q5HID5|RL7_STAAC 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain COL) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|A5IQ94|RL7_STAA9 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain JH9) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|P48860|RL7_STAA8 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplL PE=3 SV=2 107 175 6.0E-10
sp|Q2FJA0|RL7_STAA3 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain USA300) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|A6TZ17|RL7_STAA2 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain JH1) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|A7WYW4|RL7_STAA1 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplL PE=3 SV=1 107 175 6.0E-10
sp|B1GZ74|RL7_UNCTG 50S ribosomal protein L7/L12 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rplL PE=3 SV=1 47 175 7.0E-10
sp|Q98QS2|RL7_MYCPU 50S ribosomal protein L7/L12 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rplL PE=3 SV=1 107 178 9.0E-10
sp|Q160X6|RL7_ROSDO 50S ribosomal protein L7/L12 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplL PE=3 SV=1 45 175 1.0E-09
sp|Q5NPK7|RL7_ZYMMO 50S ribosomal protein L7/L12 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplL PE=3 SV=1 107 175 1.0E-09
sp|A1QZH8|RL7_BORT9 50S ribosomal protein L7/L12 OS=Borrelia turicatae (strain 91E135) GN=rplL PE=3 SV=1 87 175 1.0E-09
sp|Q2JTQ2|RL7_SYNJA 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplL PE=3 SV=1 42 175 1.0E-09
sp|B5YEX7|RL7_DICT6 50S ribosomal protein L7/L12 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplL PE=3 SV=1 47 175 1.0E-09
sp|B7MRB2|RL7_ECO81 50S ribosomal protein L7/L12 OS=Escherichia coli O81 (strain ED1a) GN=rplL PE=3 SV=1 47 175 1.0E-09
sp|A5FZX2|RL7_ACICJ 50S ribosomal protein L7/L12 OS=Acidiphilium cryptum (strain JF-5) GN=rplL PE=3 SV=1 45 175 2.0E-09
sp|A0T0Q7|RK12_THAPS 50S ribosomal protein L12, chloroplastic OS=Thalassiosira pseudonana GN=rpl12 PE=3 SV=1 42 166 2.0E-09
sp|Q9RST0|RL7_DEIRA 50S ribosomal protein L7/L12 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rplL PE=1 SV=1 48 175 2.0E-09
sp|Q2GCD1|RL7_NOVAD 50S ribosomal protein L7/L12 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplL PE=3 SV=1 45 175 2.0E-09
sp|Q7U3T9|RL7_SYNPX 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain WH8102) GN=rplL PE=3 SV=1 108 177 2.0E-09
sp|Q1KVU3|RK12_ACUOB 50S ribosomal protein L12, chloroplastic OS=Acutodesmus obliquus GN=rpl12 PE=3 SV=1 45 175 2.0E-09
sp|Q0SNB7|RL7_BORAP 50S ribosomal protein L7/L12 OS=Borrelia afzelii (strain PKo) GN=rplL PE=3 SV=1 58 175 3.0E-09
sp|A5VR16|RL7_BRUO2 50S ribosomal protein L7/L12 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplL PE=3 SV=1 45 175 3.0E-09
sp|Q8DM25|RL7_THEEB 50S ribosomal protein L7/L12 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplL PE=3 SV=1 47 175 4.0E-09
sp|B3EL60|RL7_CHLPB 50S ribosomal protein L7/L12 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplL PE=3 SV=1 45 175 4.0E-09
sp|A6X0A8|RL7_OCHA4 50S ribosomal protein L7/L12 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplL PE=3 SV=1 45 175 4.0E-09
sp|Q3AUJ8|RL7_SYNS9 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain CC9902) GN=rplL PE=3 SV=1 108 177 4.0E-09
sp|C1D0S3|RL7_DEIDV 50S ribosomal protein L7/L12 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rplL PE=3 SV=1 48 175 5.0E-09
sp|B3QQS3|RL7_CHLP8 50S ribosomal protein L7/L12 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplL PE=3 SV=1 45 178 5.0E-09
sp|A1BD22|RL7_CHLPD 50S ribosomal protein L7/L12 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplL PE=3 SV=1 45 175 6.0E-09
sp|Q3AGT2|RL7_SYNSC 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain CC9605) GN=rplL PE=3 SV=1 108 177 6.0E-09
sp|Q8F0S1|RL7_LEPIN 50S ribosomal protein L7/L12 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplL PE=3 SV=1 48 175 6.0E-09
sp|Q72UA9|RL7_LEPIC 50S ribosomal protein L7/L12 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplL PE=3 SV=1 48 175 6.0E-09
sp|A1REA6|RL7_SHESW 50S ribosomal protein L7/L12 OS=Shewanella sp. (strain W3-18-1) GN=rplL PE=3 SV=1 47 175 6.0E-09
sp|A4YBZ1|RL7_SHEPC 50S ribosomal protein L7/L12 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplL PE=3 SV=1 47 175 6.0E-09
sp|Q8EK75|RL7_SHEON 50S ribosomal protein L7/L12 OS=Shewanella oneidensis (strain MR-1) GN=rplL PE=3 SV=1 47 175 6.0E-09
sp|Q1IHH3|RL7_KORVE 50S ribosomal protein L7/L12 OS=Koribacter versatilis (strain Ellin345) GN=rplL PE=3 SV=1 45 175 7.0E-09
sp|B5RRJ8|RL7_BORRA 50S ribosomal protein L7/L12 OS=Borrelia recurrentis (strain A1) GN=rplL PE=3 SV=1 107 175 7.0E-09
sp|B5RLV0|RL7_BORDL 50S ribosomal protein L7/L12 OS=Borrelia duttonii (strain Ly) GN=rplL PE=3 SV=1 107 175 7.0E-09
sp|Q2N5R5|RL7_ERYLH 50S ribosomal protein L7/L12 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplL PE=3 SV=1 45 175 1.0E-08
sp|Q7V476|RL7_PROMM 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplL PE=3 SV=1 108 175 1.0E-08
sp|Q98N67|RL7_RHILO 50S ribosomal protein L7/L12 OS=Rhizobium loti (strain MAFF303099) GN=rplL PE=3 SV=1 45 175 1.0E-08
sp|B8D6V1|RL7_BUCAT 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplL PE=3 SV=1 47 175 1.0E-08
sp|P57147|RL7_BUCAI 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplL PE=3 SV=1 47 175 1.0E-08
sp|B8D8J7|RL7_BUCA5 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplL PE=3 SV=1 47 175 1.0E-08
sp|Q7VRP6|RL7_BLOFL 50S ribosomal protein L7/L12 OS=Blochmannia floridanus GN=rplL PE=3 SV=1 47 175 1.0E-08
sp|P0A469|RL7_BRUSU 50S ribosomal protein L7/L12 OS=Brucella suis biovar 1 (strain 1330) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|B0CH42|RL7_BRUSI 50S ribosomal protein L7/L12 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|P0A468|RL7_BRUME 50S ribosomal protein L7/L12 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|C0RJL2|RL7_BRUMB 50S ribosomal protein L7/L12 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|A9M5R1|RL7_BRUC2 50S ribosomal protein L7/L12 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|P0A470|RL7_BRUAB 50S ribosomal protein L7/L12 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|Q2YM14|RL7_BRUA2 50S ribosomal protein L7/L12 OS=Brucella abortus (strain 2308) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|B2S688|RL7_BRUA1 50S ribosomal protein L7/L12 OS=Brucella abortus (strain S19) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|Q058E4|RL7_BUCCC 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rplL PE=3 SV=1 47 173 2.0E-08
sp|Q8KG16|RL7_CHLTE 50S ribosomal protein L7/L12 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplL PE=3 SV=1 45 178 2.0E-08
sp|Q3ATP6|RL7_CHLCH 50S ribosomal protein L7/L12 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|B2IK54|RL7_BEII9 50S ribosomal protein L7/L12 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplL PE=3 SV=1 45 175 2.0E-08
sp|C6DHR4|RL7_PECCP 50S ribosomal protein L7/L12 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplL PE=3 SV=1 107 175 3.0E-08
sp|A5CW26|RL7_VESOH 50S ribosomal protein L7/L12 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplL PE=3 SV=1 47 175 3.0E-08
sp|Q8YLJ5|RL7_NOSS1 50S ribosomal protein L7/L12 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplL PE=3 SV=3 47 167 3.0E-08
sp|A5VC06|RL7_SPHWW 50S ribosomal protein L7/L12 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplL PE=3 SV=1 119 175 3.0E-08
sp|B4UDT3|RL7_ANASK 50S ribosomal protein L7/L12 OS=Anaeromyxobacter sp. (strain K) GN=rplL PE=3 SV=1 48 175 4.0E-08
sp|B8JB71|RL7_ANAD2 50S ribosomal protein L7/L12 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplL PE=3 SV=1 48 175 4.0E-08
sp|Q3B1H6|RL7_CHLL7 50S ribosomal protein L7/L12 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplL PE=3 SV=1 45 175 4.0E-08
sp|B1XJG9|RL7_SYNP2 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplL PE=3 SV=1 47 173 4.0E-08
sp|Q6A6K5|RL7_PROAC 50S ribosomal protein L7/L12 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplL PE=3 SV=1 123 177 4.0E-08
sp|A4SGK7|RL7_CHLPM 50S ribosomal protein L7/L12 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplL PE=3 SV=1 107 175 5.0E-08
sp|Q3YUZ8|RL7_SHISS 50S ribosomal protein L7/L12 OS=Shigella sonnei (strain Ss046) GN=rplL PE=3 SV=3 107 175 6.0E-08
sp|A8AKU0|RL7_CITK8 50S ribosomal protein L7/L12 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplL PE=3 SV=1 107 175 6.0E-08
sp|A7GK11|RL7_BACCN 50S ribosomal protein L7/L12 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplL PE=3 SV=1 47 175 6.0E-08
sp|B3QYL3|RL7_CHLT3 50S ribosomal protein L7/L12 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplL PE=3 SV=1 45 177 6.0E-08
sp|Q73JJ6|RL7_TREDE 50S ribosomal protein L7/L12 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplL PE=3 SV=1 107 175 7.0E-08
sp|Q11HB2|RL7_CHESB 50S ribosomal protein L7/L12 OS=Chelativorans sp. (strain BNC1) GN=rplL PE=3 SV=1 45 175 7.0E-08
sp|B4SG12|RL7_PELPB 50S ribosomal protein L7/L12 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rplL PE=3 SV=1 45 175 8.0E-08
sp|Q65W43|RL7_MANSM 50S ribosomal protein L7/L12 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplL PE=3 SV=1 107 175 9.0E-08
sp|Q5WZM0|RL7_LEGPL 50S ribosomal protein L7/L12 OS=Legionella pneumophila (strain Lens) GN=rplL PE=3 SV=1 47 175 9.0E-08
sp|Q5ZYQ1|RL7_LEGPH 50S ribosomal protein L7/L12 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplL PE=3 SV=1 47 175 9.0E-08
sp|A5IHS2|RL7_LEGPC 50S ribosomal protein L7/L12 OS=Legionella pneumophila (strain Corby) GN=rplL PE=3 SV=1 47 175 9.0E-08
sp|Q5X867|RL7_LEGPA 50S ribosomal protein L7/L12 OS=Legionella pneumophila (strain Paris) GN=rplL PE=3 SV=1 47 175 9.0E-08
sp|B7J1W2|RL7_BORBZ 50S ribosomal protein L7/L12 OS=Borrelia burgdorferi (strain ZS7) GN=rplL PE=3 SV=1 107 175 1.0E-07
sp|O51351|RL7_BORBU 50S ribosomal protein L7/L12 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplL PE=3 SV=1 107 175 1.0E-07
sp|Q11QA4|RL7_CYTH3 50S ribosomal protein L7/L12 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplL PE=3 SV=1 50 175 1.0E-07
sp|A6TGN9|RL7_KLEP7 50S ribosomal protein L7/L12 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplL PE=3 SV=1 107 175 1.0E-07
sp|B5XYF6|RL7_KLEP3 50S ribosomal protein L7/L12 OS=Klebsiella pneumoniae (strain 342) GN=rplL PE=3 SV=1 107 175 1.0E-07
sp|P36247|RL7_LIBAS 50S ribosomal protein L7/L12 OS=Liberibacter asiaticus GN=rplL PE=3 SV=1 45 174 1.0E-07
sp|B8EMS0|RL7_METSB 50S ribosomal protein L7/L12 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplL PE=3 SV=1 45 175 1.0E-07
sp|B2S093|RL7_BORHD 50S ribosomal protein L7/L12 OS=Borrelia hermsii (strain HS1 / DAH) GN=rplL PE=3 SV=1 107 175 1.0E-07
sp|A9ISF8|RL7_BART1 50S ribosomal protein L7/L12 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplL PE=3 SV=1 45 175 1.0E-07
sp|B8FEU2|RL7_DESAA 50S ribosomal protein L7/L12 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplL PE=3 SV=1 107 175 1.0E-07
sp|Q1GSF9|RL7_SPHAL 50S ribosomal protein L7/L12 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplL PE=3 SV=1 45 175 1.0E-07
sp|P0A467|RL7_AQUPY 50S ribosomal protein L7/L12 OS=Aquifex pyrophilus GN=rplL PE=3 SV=1 45 175 1.0E-07
sp|P0A466|RL7_AQUAE 50S ribosomal protein L7/L12 OS=Aquifex aeolicus (strain VF5) GN=rplL PE=3 SV=1 45 175 1.0E-07
sp|A9H3S4|RL7_GLUDA 50S ribosomal protein L7/L12 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplL PE=3 SV=1 45 175 1.0E-07
sp|B6JER8|RL7_OLICO 50S ribosomal protein L7/L12 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplL PE=3 SV=1 45 175 1.0E-07
sp|Q3YST6|RL7_EHRCJ 50S ribosomal protein L7/L12 OS=Ehrlichia canis (strain Jake) GN=rplL PE=3 SV=1 45 146 1.0E-07
sp|P41188|RL7_BUCAP 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplL PE=3 SV=2 47 175 2.0E-07
sp|P0A7K5|RL7_SHIFL 50S ribosomal protein L7/L12 OS=Shigella flexneri GN=rplL PE=3 SV=2 107 175 2.0E-07
sp|Q0SY14|RL7_SHIF8 50S ribosomal protein L7/L12 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|Q32AF8|RL7_SHIDS 50S ribosomal protein L7/L12 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplL PE=3 SV=3 107 175 2.0E-07
sp|Q31U11|RL7_SHIBS 50S ribosomal protein L7/L12 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplL PE=3 SV=3 107 175 2.0E-07
sp|B2TWH2|RL7_SHIB3 50S ribosomal protein L7/L12 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B7LUL6|RL7_ESCF3 50S ribosomal protein L7/L12 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|Q1R5V1|RL7_ECOUT 50S ribosomal protein L7/L12 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B1LNT8|RL7_ECOSM 50S ribosomal protein L7/L12 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B6I5J6|RL7_ECOSE 50S ribosomal protein L7/L12 OS=Escherichia coli (strain SE11) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B7NFS6|RL7_ECOLU 50S ribosomal protein L7/L12 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|P0A7K2|RL7_ECOLI 50S ribosomal protein L7/L12 OS=Escherichia coli (strain K12) GN=rplL PE=1 SV=2 107 175 2.0E-07
sp|B1IUR1|RL7_ECOLC 50S ribosomal protein L7/L12 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|P0A7K3|RL7_ECOL6 50S ribosomal protein L7/L12 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplL PE=3 SV=2 107 175 2.0E-07
sp|Q0TA79|RL7_ECOL5 50S ribosomal protein L7/L12 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|A8A785|RL7_ECOHS 50S ribosomal protein L7/L12 OS=Escherichia coli O9:H4 (strain HS) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B1XBY8|RL7_ECODH 50S ribosomal protein L7/L12 OS=Escherichia coli (strain K12 / DH10B) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|C5A0S6|RL7_ECOBW 50S ribosomal protein L7/L12 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B7M733|RL7_ECO8A 50S ribosomal protein L7/L12 OS=Escherichia coli O8 (strain IAI1) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B7NRR4|RL7_ECO7I 50S ribosomal protein L7/L12 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B5Z082|RL7_ECO5E 50S ribosomal protein L7/L12 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|P0A7K4|RL7_ECO57 50S ribosomal protein L7/L12 OS=Escherichia coli O157:H7 GN=rplL PE=3 SV=2 107 175 2.0E-07
sp|B7LA79|RL7_ECO55 50S ribosomal protein L7/L12 OS=Escherichia coli (strain 55989 / EAEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B7MIX2|RL7_ECO45 50S ribosomal protein L7/L12 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|B7UPE1|RL7_ECO27 50S ribosomal protein L7/L12 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|A7ZUK0|RL7_ECO24 50S ribosomal protein L7/L12 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|A7MQP6|RL7_CROS8 50S ribosomal protein L7/L12 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplL PE=3 SV=1 47 175 2.0E-07
sp|B3QC01|RL7_RHOPT 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplL PE=3 SV=1 45 175 2.0E-07
sp|Q6N4R8|RL7_RHOPA 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplL PE=1 SV=3 45 175 2.0E-07
sp|Q3ILQ0|RL7_PSEHT 50S ribosomal protein L7/L12 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplL PE=3 SV=1 47 175 2.0E-07
sp|Q6DAN1|RL7_PECAS 50S ribosomal protein L7/L12 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplL PE=3 SV=1 107 175 2.0E-07
sp|Q9L5W4|RL7_LIBAC 50S ribosomal protein L7/L12 OS=Liberibacter africanus subsp. capensis GN=rplL PE=3 SV=1 45 177 2.0E-07
sp|P56345|RK12_CHLVU 50S ribosomal protein L12, chloroplastic OS=Chlorella vulgaris GN=rpl12 PE=3 SV=1 38 175 2.0E-07
sp|Q2NWR7|RL7_SODGM 50S ribosomal protein L7/L12 OS=Sodalis glossinidius (strain morsitans) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|Q28UX8|RL7_JANSC 50S ribosomal protein L7/L12 OS=Jannaschia sp. (strain CCS1) GN=rplL PE=3 SV=1 45 175 2.0E-07
sp|P0A299|RL7_SALTY 50S ribosomal protein L7/L12 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplL PE=3 SV=2 108 175 2.0E-07
sp|P0A2A0|RL7_SALTI 50S ribosomal protein L7/L12 OS=Salmonella typhi GN=rplL PE=3 SV=2 108 175 2.0E-07
sp|B4TQJ4|RL7_SALSV 50S ribosomal protein L7/L12 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|B5BJQ2|RL7_SALPK 50S ribosomal protein L7/L12 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|C0Q2R6|RL7_SALPC 50S ribosomal protein L7/L12 OS=Salmonella paratyphi C (strain RKS4594) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|A9N0J3|RL7_SALPB 50S ribosomal protein L7/L12 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|Q5PK94|RL7_SALPA 50S ribosomal protein L7/L12 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplL PE=3 SV=3 108 175 2.0E-07
sp|B4T0Y8|RL7_SALNS 50S ribosomal protein L7/L12 OS=Salmonella newport (strain SL254) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|B4TCS3|RL7_SALHS 50S ribosomal protein L7/L12 OS=Salmonella heidelberg (strain SL476) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|B5RFK2|RL7_SALG2 50S ribosomal protein L7/L12 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|B5QYD7|RL7_SALEP 50S ribosomal protein L7/L12 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|B5FQJ8|RL7_SALDC 50S ribosomal protein L7/L12 OS=Salmonella dublin (strain CT_02021853) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|Q57H70|RL7_SALCH 50S ribosomal protein L7/L12 OS=Salmonella choleraesuis (strain SC-B67) GN=rplL PE=3 SV=3 108 175 2.0E-07
sp|B5F0W6|RL7_SALA4 50S ribosomal protein L7/L12 OS=Salmonella agona (strain SL483) GN=rplL PE=3 SV=1 108 175 2.0E-07
sp|A0KQA6|RL7_AERHH 50S ribosomal protein L7/L12 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplL PE=3 SV=1 47 175 2.0E-07
sp|A9MHF3|RL7_SALAR 50S ribosomal protein L7/L12 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplL PE=3 SV=1 108 175 3.0E-07
sp|B3WA01|RL7_LACCB 50S ribosomal protein L7/L12 OS=Lactobacillus casei (strain BL23) GN=rplL PE=3 SV=1 122 177 3.0E-07
sp|Q035V6|RL7_LACC3 50S ribosomal protein L7/L12 OS=Lactobacillus casei (strain ATCC 334) GN=rplL PE=3 SV=1 122 177 3.0E-07
sp|O99010|RK12_PROWI 50S ribosomal protein L12, plastid OS=Prototheca wickerhamii GN=rpl12 PE=3 SV=2 47 175 3.0E-07
sp|A4W5A6|RL7_ENT38 50S ribosomal protein L7/L12 OS=Enterobacter sp. (strain 638) GN=rplL PE=3 SV=1 108 175 3.0E-07
sp|Q06036|RK122_SECCE 50S ribosomal protein L12-2, chloroplastic OS=Secale cereale GN=RPL12-2 PE=2 SV=1 40 175 3.0E-07
sp|A4YSI0|RL7_BRASO 50S ribosomal protein L7/L12 OS=Bradyrhizobium sp. (strain ORS278) GN=rplL PE=3 SV=1 45 175 3.0E-07
sp|A7I3U0|RL7_CAMHC 50S ribosomal protein L7/L12 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rplL PE=3 SV=1 48 175 4.0E-07
sp|Q06030|RK121_SECCE 50S ribosomal protein L12-1, chloroplastic OS=Secale cereale GN=RPL12-1 PE=2 SV=1 40 175 4.0E-07
sp|P02395|RL7_MICLU 50S ribosomal protein L7/L12 OS=Micrococcus luteus GN=rplL PE=1 SV=1 47 175 4.0E-07
sp|Q1J0P3|RL7_DEIGD 50S ribosomal protein L7/L12 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplL PE=3 SV=1 48 175 4.0E-07
sp|B4U736|RL7_HYDS0 50S ribosomal protein L7/L12 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rplL PE=3 SV=1 45 175 4.0E-07
sp|B8IS76|RL7_METNO 50S ribosomal protein L7/L12 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplL PE=3 SV=1 45 175 4.0E-07
sp|A8GMA6|RL7_RICAH 50S ribosomal protein L7/L12 OS=Rickettsia akari (strain Hartford) GN=rplL PE=3 SV=1 45 175 4.0E-07
sp|A1JIH9|RL7_YERE8 50S ribosomal protein L7/L12 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplL PE=3 SV=1 108 175 5.0E-07
sp|A9R0H7|RL7_YERPG 50S ribosomal protein L7/L12 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplL PE=3 SV=1 47 175 5.0E-07
sp|B1X073|RL7_CYAA5 50S ribosomal protein L7/L12 OS=Cyanothece sp. (strain ATCC 51142) GN=rplL PE=3 SV=1 47 175 6.0E-07
sp|A1USC7|RL7_BARBK 50S ribosomal protein L7/L12 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplL PE=3 SV=1 45 175 6.0E-07
sp|Q6FZL8|RL7_BARQU 50S ribosomal protein L7/L12 OS=Bartonella quintana (strain Toulouse) GN=rplL PE=3 SV=1 45 175 6.0E-07
sp|Q9TLZ9|RK12_CYACA 50S ribosomal protein L12, chloroplastic OS=Cyanidium caldarium GN=rpl12 PE=3 SV=1 44 177 7.0E-07
sp|A5GWJ9|RL7_SYNR3 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain RCC307) GN=rplL PE=3 SV=1 108 177 7.0E-07
sp|P23349|RL7_SYNY3 50S ribosomal protein L7/L12 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplL PE=1 SV=3 47 173 7.0E-07
sp|B7JWT5|RL7_CYAP8 50S ribosomal protein L7/L12 OS=Cyanothece sp. (strain PCC 8801) GN=rplL PE=3 SV=1 47 173 7.0E-07
sp|Q18CE7|RL7_PEPD6 50S ribosomal protein L7/L12 OS=Peptoclostridium difficile (strain 630) GN=rplL PE=3 SV=1 45 175 9.0E-07
sp|Q15YB2|RL7_PSEA6 50S ribosomal protein L7/L12 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|B2G5T7|RL7_LACRJ 50S ribosomal protein L7/L12 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplL PE=3 SV=1 120 177 1.0E-06
sp|A5VIB0|RL7_LACRD 50S ribosomal protein L7/L12 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplL PE=3 SV=1 120 177 1.0E-06
sp|Q5FTX6|RL7_GLUOX 50S ribosomal protein L7/L12 OS=Gluconobacter oxydans (strain 621H) GN=rplL PE=3 SV=1 45 175 1.0E-06
sp|A9NEL5|RL7_ACHLI 50S ribosomal protein L7/L12 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplL PE=3 SV=1 49 175 1.0E-06
sp|Q4A7A8|RL7_MYCH7 50S ribosomal protein L7/L12 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rplL PE=3 SV=1 47 178 1.0E-06
sp|Q3ZXY0|RL7_DEHMC 50S ribosomal protein L7/L12 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplL PE=3 SV=1 107 175 1.0E-06
sp|P02398|RK12_SPIOL 50S ribosomal protein L12, chloroplastic OS=Spinacia oleracea GN=RPL12 PE=1 SV=2 44 175 1.0E-06
sp|B1JJJ7|RL7_YERPY 50S ribosomal protein L7/L12 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|Q66FQ3|RL7_YERPS 50S ribosomal protein L7/L12 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|A4TS30|RL7_YERPP 50S ribosomal protein L7/L12 OS=Yersinia pestis (strain Pestoides F) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|Q1CN79|RL7_YERPN 50S ribosomal protein L7/L12 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|Q8ZAP4|RL7_YERPE 50S ribosomal protein L7/L12 OS=Yersinia pestis GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|B2K111|RL7_YERPB 50S ribosomal protein L7/L12 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|Q1C1U0|RL7_YERPA 50S ribosomal protein L7/L12 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|A7FNI4|RL7_YERP3 50S ribosomal protein L7/L12 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|B5Z8J6|RL7_HELPG 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain G27) GN=rplL PE=3 SV=1 47 175 1.0E-06
sp|B6JN38|RL7_HELP2 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain P12) GN=rplL PE=3 SV=1 47 175 1.0E-06
sp|B2VG95|RL7_ERWT9 50S ribosomal protein L7/L12 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplL PE=3 SV=1 108 175 1.0E-06
sp|P44348|RL7_HAEIN 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplL PE=3 SV=2 107 175 1.0E-06
sp|A5UHD2|RL7_HAEIG 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain PittGG) GN=rplL PE=3 SV=1 107 175 1.0E-06
sp|A5UE95|RL7_HAEIE 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain PittEE) GN=rplL PE=3 SV=1 107 175 1.0E-06
sp|Q4QMS6|RL7_HAEI8 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain 86-028NP) GN=rplL PE=3 SV=1 107 175 1.0E-06
sp|Q5N3N6|RL7_SYNP6 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplL PE=3 SV=1 42 175 1.0E-06
sp|Q31QK6|RL7_SYNE7 50S ribosomal protein L7/L12 OS=Synechococcus elongatus (strain PCC 7942) GN=rplL PE=3 SV=1 42 175 1.0E-06
sp|Q6G3X6|RL7_BARHE 50S ribosomal protein L7/L12 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplL PE=3 SV=1 45 175 1.0E-06
sp|A5FQQ9|RL7_DEHMB 50S ribosomal protein L7/L12 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplL PE=3 SV=1 107 175 1.0E-06
sp|Q89J73|RL7_BRADU 50S ribosomal protein L7/L12 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplL PE=3 SV=1 45 175 2.0E-06
sp|A8EXK7|RL7_RICCK 50S ribosomal protein L7/L12 OS=Rickettsia canadensis (strain McKiel) GN=rplL PE=3 SV=1 45 175 2.0E-06
sp|A8G8E6|RL7_SERP5 50S ribosomal protein L7/L12 OS=Serratia proteamaculans (strain 568) GN=rplL PE=3 SV=1 108 175 2.0E-06
sp|A5ELN8|RL7_BRASB 50S ribosomal protein L7/L12 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplL PE=3 SV=1 45 175 2.0E-06
sp|Q2IXS1|RL7_RHOP2 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplL PE=3 SV=1 45 175 2.0E-06
sp|B1HMZ8|RL7_LYSSC 50S ribosomal protein L7/L12 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplL PE=3 SV=1 47 175 2.0E-06
sp|C4K4F2|RL7_HAMD5 50S ribosomal protein L7/L12 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplL PE=3 SV=1 108 175 2.0E-06
sp|B0K5G7|RL7_THEPX 50S ribosomal protein L7/L12 OS=Thermoanaerobacter sp. (strain X514) GN=rplL PE=3 SV=1 47 175 2.0E-06
sp|Q8ETZ0|RL7_OCEIH 50S ribosomal protein L7/L12 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplL PE=3 SV=1 107 175 2.0E-06
sp|Q2EEW8|RK12_HELSJ 50S ribosomal protein L12, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=rpl12 PE=3 SV=1 42 177 2.0E-06
sp|A8GYW8|RL7_SHEPA 50S ribosomal protein L7/L12 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplL PE=3 SV=1 47 175 2.0E-06
sp|B0KCJ1|RL7_THEP3 50S ribosomal protein L7/L12 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplL PE=3 SV=1 47 175 2.0E-06
sp|P48124|RK12_CYAPA 50S ribosomal protein L12, cyanelle OS=Cyanophora paradoxa GN=rpl12 PE=3 SV=1 44 171 2.0E-06
sp|Q3SSY1|RL7_NITWN 50S ribosomal protein L7/L12 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplL PE=3 SV=1 45 175 2.0E-06
sp|Q724G1|RL7_LISMF 50S ribosomal protein L7/L12 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplL PE=3 SV=1 107 175 2.0E-06
sp|C1KYI3|RL7_LISMC 50S ribosomal protein L7/L12 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplL PE=3 SV=1 107 175 2.0E-06
sp|Q7NK76|RL7_GLOVI 50S ribosomal protein L7/L12 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplL PE=3 SV=1 42 173 2.0E-06
sp|Q74L08|RL7_LACJO 50S ribosomal protein L7/L12 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplL PE=3 SV=1 107 177 2.0E-06
sp|Q045V5|RL7_LACGA 50S ribosomal protein L7/L12 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplL PE=3 SV=1 107 177 2.0E-06
sp|Q3A9Q5|RL7_CARHZ 50S ribosomal protein L7/L12 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplL PE=3 SV=1 44 175 2.0E-06
sp|Q0BUQ8|RL7_GRABC 50S ribosomal protein L7/L12 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplL PE=3 SV=1 45 175 2.0E-06
sp|Q07KK6|RL7_RHOP5 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplL PE=3 SV=1 45 175 3.0E-06
sp|Q211D7|RL7_RHOPB 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplL PE=3 SV=1 45 175 3.0E-06
sp|Q2W2I0|RL7_MAGSA 50S ribosomal protein L7/L12 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplL PE=3 SV=1 45 175 3.0E-06
sp|Q38V11|RL7_LACSS 50S ribosomal protein L7/L12 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplL PE=3 SV=1 48 175 3.0E-06
sp|A1B014|RL7_PARDP 50S ribosomal protein L7/L12 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplL PE=3 SV=1 45 175 3.0E-06
sp|Q3Z7T6|RL7_DEHM1 50S ribosomal protein L7/L12 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplL PE=3 SV=1 107 175 3.0E-06
sp|A0AF50|RL7_LISW6 50S ribosomal protein L7/L12 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplL PE=3 SV=1 122 175 3.0E-06
sp|Q134R7|RL7_RHOPS 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplL PE=3 SV=1 45 175 3.0E-06
sp|Q2GFP2|RL7_EHRCR 50S ribosomal protein L7/L12 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rplL PE=3 SV=1 45 146 4.0E-06
sp|B4EYV0|RL7_PROMH 50S ribosomal protein L7/L12 OS=Proteus mirabilis (strain HI4320) GN=rplL PE=3 SV=1 108 175 4.0E-06
sp|B2UUW1|RL7_HELPS 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain Shi470) GN=rplL PE=3 SV=1 47 175 4.0E-06
sp|P56875|RL7_HELPJ 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rplL PE=3 SV=1 47 175 4.0E-06
sp|Q1CS67|RL7_HELPH 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain HPAG1) GN=rplL PE=3 SV=1 47 175 4.0E-06
sp|P55834|RL7_HELPY 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rplL PE=1 SV=1 47 175 4.0E-06
sp|Q4A968|RL7_MYCHJ 50S ribosomal protein L7/L12 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rplL PE=3 SV=1 47 178 4.0E-06
sp|Q5ZZS0|RL7_MYCH2 50S ribosomal protein L7/L12 OS=Mycoplasma hyopneumoniae (strain 232) GN=rplL PE=3 SV=1 47 178 4.0E-06
sp|B1VAM7|RL7_PHYAS 50S ribosomal protein L7/L12 OS=Phytoplasma australiense GN=rplL PE=3 SV=1 49 175 4.0E-06
sp|Q1LSX8|RL7_BAUCH 50S ribosomal protein L7/L12 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplL PE=3 SV=1 47 175 4.0E-06
sp|B0UHX7|RL7_METS4 50S ribosomal protein L7/L12 OS=Methylobacterium sp. (strain 4-46) GN=rplL PE=3 SV=1 45 175 4.0E-06
sp|B8GV66|RL7_THISH 50S ribosomal protein L7/L12 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplL PE=3 SV=1 47 175 4.0E-06
sp|B9E8Q7|RL7_MACCJ 50S ribosomal protein L7/L12 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplL PE=3 SV=1 107 175 4.0E-06
sp|Q2S904|RL7_HAHCH 50S ribosomal protein L7/L12 OS=Hahella chejuensis (strain KCTC 2396) GN=rplL PE=3 SV=1 107 175 4.0E-06
sp|Q6AP79|RL7_DESPS 50S ribosomal protein L7/L12 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplL PE=3 SV=1 108 174 5.0E-06
sp|B2GIJ4|RL7_KOCRD 50S ribosomal protein L7/L12 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rplL PE=3 SV=1 47 177 5.0E-06
sp|Q85G10|RK12_CYAME 50S ribosomal protein L12, chloroplastic OS=Cyanidioschyzon merolae GN=rpl12 PE=3 SV=1 42 175 5.0E-06
sp|A6GYU1|RL7_FLAPJ 50S ribosomal protein L7/L12 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplL PE=3 SV=1 45 175 5.0E-06
sp|Q17VN5|RL7_HELAH 50S ribosomal protein L7/L12 OS=Helicobacter acinonychis (strain Sheeba) GN=rplL PE=3 SV=1 47 175 6.0E-06
sp|Q1ACG9|RK12_CHAVU 50S ribosomal protein L12, chloroplastic OS=Chara vulgaris GN=rpl12 PE=3 SV=2 45 177 6.0E-06
sp|P58138|RK12_EUGLO 50S ribosomal protein L12, plastid OS=Euglena longa GN=rpl12 PE=3 SV=1 99 177 7.0E-06
sp|B2KEN2|RL7_ELUMP 50S ribosomal protein L7/L12 OS=Elusimicrobium minutum (strain Pei191) GN=rplL PE=3 SV=1 107 177 7.0E-06
sp|Q7VJ81|RL7_HELHP 50S ribosomal protein L7/L12 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rplL PE=3 SV=1 47 175 7.0E-06
sp|B7KIR5|RL7_CYAP7 50S ribosomal protein L7/L12 OS=Cyanothece sp. (strain PCC 7424) GN=rplL PE=3 SV=1 104 177 8.0E-06
sp|A6VKC6|RL7_ACTSZ 50S ribosomal protein L7/L12 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplL PE=3 SV=1 107 175 8.0E-06
sp|Q1QN45|RL7_NITHX 50S ribosomal protein L7/L12 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplL PE=3 SV=1 45 175 8.0E-06
sp|Q1WST5|RL7_LACS1 50S ribosomal protein L7/L12 OS=Lactobacillus salivarius (strain UCC118) GN=rplL PE=3 SV=1 107 177 9.0E-06
sp|B6YPZ8|RL7_AZOPC 50S ribosomal protein L7/L12 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rplL PE=3 SV=1 50 175 9.0E-06
sp|B8DF04|RL7_LISMH 50S ribosomal protein L7/L12 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplL PE=3 SV=1 107 175 9.0E-06
sp|Q92F24|RL7_LISIN 50S ribosomal protein L7/L12 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplL PE=3 SV=1 107 175 9.0E-06
sp|B1LY44|RL7_METRJ 50S ribosomal protein L7/L12 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplL PE=3 SV=1 45 175 9.0E-06
sp|A1T066|RL7_PSYIN 50S ribosomal protein L7/L12 OS=Psychromonas ingrahamii (strain 37) GN=rplL PE=3 SV=1 47 175 9.0E-06
sp|A7IKP9|RL7_XANP2 50S ribosomal protein L7/L12 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplL PE=3 SV=1 45 175 1.0E-05
sp|Q9CG42|RL7_LACLA 50S ribosomal protein L7/L12 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplL PE=3 SV=1 123 177 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4932
MAMTCRYAARTCARQLGYSSPIQTLRVAASRRFTSTDATSTNPKIAQIVDQISKLTLLETADLVSSLKSTLNIPD
MPMGGFAAPAAGAGPAAAAPVEAEEAPPPVAEKTLFNLKFQAFDAASKAKIIKEIKGMLGLSLVDSKKFVESAPK
MLKENVPKEDAEKIIESMKALGATVVMD*
Coding >OphauG2|4932
ATGGCCATGACCTGTCGGTACGCGGCGCGCACCTGCGCCCGCCAACTTGGATACTCGAGCCCCATCCAGACCTTG
AGAGTCGCGGCATCACGACGCTTCACCTCGACCGACGCTACGTCTACGAATCCAAAAATCGCCCAGATTGTCGAC
CAGATTAGCAAGCTGACGCTGCTGGAAACAGCGGACCTGGTGTCGAGCCTCAAGAGCACGTTGAATATTCCCGAT
ATGCCCATGGGTGGCTTTGCAGCACCTGCTGCTGGAGCTGGGCCCGCGGCGGCGGCGCCTGTTGAAGCGGAGGAA
GCACCGCCACCCGTGGCGGAAAAGACGCTCTTCAATCTCAAGTTTCAAGCCTTTGATGCTGCTTCAAAGGCAAAG
ATCATCAAGGAGATCAAGGGCATGCTGGGCTTGAGCTTGGTGGACAGCAAGAAGTTTGTGGAGAGCGCGCCCAAG
ATGCTCAAGGAAAACGTGCCCAAGGAGGATGCCGAGAAGATTATTGAGAGTATGAAGGCGCTGGGCGCAACAGTG
GTTATGGACTAG
Transcript >OphauG2|4932
ATGGCCATGACCTGTCGGTACGCGGCGCGCACCTGCGCCCGCCAACTTGGATACTCGAGCCCCATCCAGACCTTG
AGAGTCGCGGCATCACGACGCTTCACCTCGACCGACGCTACGTCTACGAATCCAAAAATCGCCCAGATTGTCGAC
CAGATTAGCAAGCTGACGCTGCTGGAAACAGCGGACCTGGTGTCGAGCCTCAAGAGCACGTTGAATATTCCCGAT
ATGCCCATGGGTGGCTTTGCAGCACCTGCTGCTGGAGCTGGGCCCGCGGCGGCGGCGCCTGTTGAAGCGGAGGAA
GCACCGCCACCCGTGGCGGAAAAGACGCTCTTCAATCTCAAGTTTCAAGCCTTTGATGCTGCTTCAAAGGCAAAG
ATCATCAAGGAGATCAAGGGCATGCTGGGCTTGAGCTTGGTGGACAGCAAGAAGTTTGTGGAGAGCGCGCCCAAG
ATGCTCAAGGAAAACGTGCCCAAGGAGGATGCCGAGAAGATTATTGAGAGTATGAAGGCGCTGGGCGCAACAGTG
GTTATGGACTAG
Gene >OphauG2|4932
ATGGCCATGACCTGTCGGTACGCGGCGCGCACCTGCGCCCGCCAACTTGGATACTCGAGCCCCATCCAGACCTTG
AGAGTCGCGGCATCACGACGCTTCACCTCGACCGACGCTACGTCTACGAATCCAAAAATCGCCCAGATTGTCGAC
CAGATTAGCAAGCTGACGCTGCTGGAAACAGCGGACCTGGTGTCGAGCCTCAAGGTCAGTGTGTGGGCGTCTGGG
CTAAAAAAAAACGTGGCAGCGGCTAATTCAACCTCGCTCCCTTGTCTGCGGTACAGAGCACGTTGAATATTCCCG
ATATGCCCATGGGTGGCTTTGCAGCACCTGCTGCTGGAGCTGGGCCCGCGGCGGCGGCGCCTGTTGAAGCGGAGG
AAGCACCGCCACCCGTGGCGGAAAAGACGCTCTTCAATCTCAAGTTTCAAGCCTTTGATGCTGCTTCAAAGGCAA
AGATCATCAAGGAGATCAAGGGCATGCTGGGCTTGAGCTTGGTGGACAGCAAGAAGTTTGTGGAGAGCGCGCCCA
AGATGCTCAAGGAAAACGTGCCCAAGGAGGATGCCGAGAAGATTATTGAGAGTATGAAGGCGCTGGGCGCAACAG
TGGTTATGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail