Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4928
Gene name
LocationContig_43:22190..23104
Strand+
Gene length (bp)914
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 2.6E-21 10 206
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.4E-06 55 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FM04|GDL88_ARATH GDSL esterase/lipase At5g62930 OS=Arabidopsis thaliana GN=At5g62930 PE=2 SV=3 6 221 8.0E-24
sp|Q9SRM5|CPR49_ARATH GDSL esterase/lipase CPRD49 OS=Arabidopsis thaliana GN=CPRD49 PE=2 SV=1 6 212 2.0E-21
sp|Q6NMR9|GDL84_ARATH GDSL esterase/lipase At5g45920 OS=Arabidopsis thaliana GN=At5g45920 PE=2 SV=1 7 227 3.0E-21
sp|O80443|GDL46_ARATH GDSL esterase/lipase At2g38180 OS=Arabidopsis thaliana GN=At2g38180 PE=2 SV=1 6 220 1.0E-20
sp|Q9DB29|IAH1_MOUSE Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Mus musculus GN=Iah1 PE=1 SV=1 2 209 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FM04|GDL88_ARATH GDSL esterase/lipase At5g62930 OS=Arabidopsis thaliana GN=At5g62930 PE=2 SV=3 6 221 8.0E-24
sp|Q9SRM5|CPR49_ARATH GDSL esterase/lipase CPRD49 OS=Arabidopsis thaliana GN=CPRD49 PE=2 SV=1 6 212 2.0E-21
sp|Q6NMR9|GDL84_ARATH GDSL esterase/lipase At5g45920 OS=Arabidopsis thaliana GN=At5g45920 PE=2 SV=1 7 227 3.0E-21
sp|O80443|GDL46_ARATH GDSL esterase/lipase At2g38180 OS=Arabidopsis thaliana GN=At2g38180 PE=2 SV=1 6 220 1.0E-20
sp|Q9DB29|IAH1_MOUSE Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Mus musculus GN=Iah1 PE=1 SV=1 2 209 2.0E-20
sp|Q711G3|IAH1_RAT Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Rattus norvegicus GN=Iah1 PE=2 SV=2 5 239 2.0E-19
sp|Q3SZ16|IAH1_BOVIN Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Bos taurus GN=IAH1 PE=2 SV=1 5 243 2.0E-19
sp|Q2TAA2|IAH1_HUMAN Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens GN=IAH1 PE=1 SV=1 2 239 4.0E-18
sp|Q503L4|IAH1_DANRE Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Danio rerio GN=iah1 PE=2 SV=2 5 212 7.0E-18
sp|P41734|IAH1_YEAST Isoamyl acetate-hydrolyzing esterase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IAH1 PE=1 SV=1 5 241 1.0E-14
sp|O74648|IAH1_SCHPO Isoamyl acetate-hydrolyzing esterase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iah1 PE=2 SV=1 5 220 9.0E-10
sp|P54451|YQEF_BACSU Uncharacterized lipoprotein YqeF OS=Bacillus subtilis (strain 168) GN=yqeF PE=3 SV=1 40 213 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4928
MATSYPQVVLLGDSLLEYSTHTTEGFCFQAALQSQCIRRLDVVNRGLGGWNTSKVLKYLDDIIPKPTGSTPKMKY
LIILLGINDAALPSLSKQHVPIDEYKRNLTQIITHVNVQAHSPKILLVTPPPINEMKFRENERARGLLEGSRDFK
TSAAYSEKAREVARENEGVVLIDLWQALMDKATAQGAGGLDSLLPDGIHLAGEAYRVLYEEIKQHIGREWVYEGA
QDSSGYMYPDYRDLFDLRALLPNGW*
Coding >OphauG2|4928
ATGGCAACATCGTACCCTCAAGTTGTTTTGCTTGGAGACTCGCTGCTGGAGTATTCAACCCATACTACTGAAGGC
TTCTGCTTTCAGGCAGCTCTTCAGAGCCAATGCATCAGGCGACTCGATGTGGTGAACCGGGGCCTTGGAGGGTGG
AACACATCCAAAGTGCTCAAATACTTGGATGACATTATTCCCAAGCCTACCGGGTCGACGCCAAAGATGAAATAT
CTTATAATCTTGCTCGGAATAAATGATGCCGCCTTGCCTTCATTGTCGAAGCAACACGTTCCCATTGATGAGTAC
AAGAGGAACTTGACGCAAATCATCACACACGTCAATGTTCAGGCGCACTCGCCCAAAATTCTACTCGTTACTCCG
CCGCCAATCAACGAGATGAAGTTTCGAGAGAACGAGAGGGCCCGAGGACTGTTAGAAGGCAGTCGAGACTTTAAG
ACGAGCGCTGCGTACTCGGAAAAGGCGCGAGAGGTGGCTAGAGAGAATGAGGGCGTCGTCTTAATTGACCTTTGG
CAGGCTCTCATGGACAAGGCGACGGCCCAGGGAGCAGGGGGGCTGGACAGCCTGCTTCCGGACGGGATTCACCTA
GCCGGCGAGGCATACAGGGTCTTGTATGAGGAGATAAAGCAGCACATTGGCAGGGAGTGGGTGTATGAAGGGGCC
CAAGACAGCAGTGGCTACATGTATCCCGACTACCGGGACCTGTTCGACTTACGAGCACTGCTACCCAACGGTTGG
TGA
Transcript >OphauG2|4928
ATGGCAACATCGTACCCTCAAGTTGTTTTGCTTGGAGACTCGCTGCTGGAGTATTCAACCCATACTACTGAAGGC
TTCTGCTTTCAGGCAGCTCTTCAGAGCCAATGCATCAGGCGACTCGATGTGGTGAACCGGGGCCTTGGAGGGTGG
AACACATCCAAAGTGCTCAAATACTTGGATGACATTATTCCCAAGCCTACCGGGTCGACGCCAAAGATGAAATAT
CTTATAATCTTGCTCGGAATAAATGATGCCGCCTTGCCTTCATTGTCGAAGCAACACGTTCCCATTGATGAGTAC
AAGAGGAACTTGACGCAAATCATCACACACGTCAATGTTCAGGCGCACTCGCCCAAAATTCTACTCGTTACTCCG
CCGCCAATCAACGAGATGAAGTTTCGAGAGAACGAGAGGGCCCGAGGACTGTTAGAAGGCAGTCGAGACTTTAAG
ACGAGCGCTGCGTACTCGGAAAAGGCGCGAGAGGTGGCTAGAGAGAATGAGGGCGTCGTCTTAATTGACCTTTGG
CAGGCTCTCATGGACAAGGCGACGGCCCAGGGAGCAGGGGGGCTGGACAGCCTGCTTCCGGACGGGATTCACCTA
GCCGGCGAGGCATACAGGGTCTTGTATGAGGAGATAAAGCAGCACATTGGCAGGGAGTGGGTGTATGAAGGGGCC
CAAGACAGCAGTGGCTACATGTATCCCGACTACCGGGACCTGTTCGACTTACGAGCACTGCTACCCAACGGTTGG
TGA
Gene >OphauG2|4928
ATGGCAGTAAGTTGAGCTGCTCTTTTCCTCAAAGCTAGAGTTAATATGAGCATAGACATCGTACCCTCAAGTTGT
TTTGCTTGGAGACTCGCTGCTGGAGTATTCAACCCATACTACTGAAGGCTTCTGCTTTCAGGCAGCTCTTCAGAG
CCGTCTGTTCGCCCAACGTATTAGTGGTTTGAAGAGGTTGATGAGCTGACTTTTGTGCAGAATGCATCAGGCGAC
TCGATGTGGTGAACCGGGGCCTTGGAGGGTGGAACACATCCAAAGTGCTCAAATACTTGGATGACATTATTCCCA
AGCCTACCGGGTCGACGCCAAAGATGAAATATCTTGTGAGCAAGGTGTGGAGGGACAAAGATTGTAGTCTCACGC
TAAGAGAAGGCTAGATAATCTTGCTCGGAATAAATGATGCCGCCTTGCCTTCATTGTCGAAGCAACACGTTCCCA
TTGATGAGTACAAGAGGAACTTGACGCAAATCATCACACACGTCAATGTTCAGGCGCACTCGCCCAAAATTCTAC
TCGTTACTCCGCCGCCAATCAACGAGATGAAGTTTCGAGAGAACGAGAGGGCCCGAGGACTGTTAGAAGGCAGTC
GAGACTTTAAGACGAGCGCTGCGTACTCGGAAAAGGCGCGAGAGGTGGCTAGAGAGAATGAGGGCGTCGTCTTAA
TTGACCTTTGGCAGGCTCTCATGGACAAGGCGACGGCCCAGGGAGCAGGGGGGCTGGACAGCCTGCTTCCGGACG
GGATTCACCTAGCCGGCGAGGCATACAGGGTCTTGTATGAGGAGATAAAGCAGCACATTGGCAGGGAGTGGGTGT
ATGAAGGGGCCCAAGACAGCAGTGGCTACATGTATCCCGACTACCGGGACCTGTTCGACTTACGAGCACTGCTAC
CCAACGGTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail