Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4927
Gene name
LocationContig_43:15518..21052
Strand-
Gene length (bp)5534
Transcript length (bp)5415
Coding sequence length (bp)5415
Protein length (aa) 1805

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08146 BP28CT BP28CT (NUC211) domain 8.0E-41 1524 1675
PF12397 U3snoRNP10 U3 small nucleolar RNA-associated protein 10 1.8E-25 247 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZM8|UTP10_NEUCR U3 small nucleolar RNA-associated protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rbg-5 PE=3 SV=1 3 1804 0.0E+00
sp|A4QTQ9|UTP10_MAGO7 U3 small nucleolar RNA-associated protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UTP10 PE=3 SV=2 1 1804 0.0E+00
sp|Q0V1B1|UTP10_PHANO U3 small nucleolar RNA-associated protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=UTP10 PE=3 SV=2 186 1804 0.0E+00
sp|Q5B1X5|UTP10_EMENI U3 small nucleolar RNA-associated protein 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|A5AB61|UTP10_ASPNC U3 small nucleolar RNA-associated protein 10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZM8|UTP10_NEUCR U3 small nucleolar RNA-associated protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rbg-5 PE=3 SV=1 3 1804 0.0E+00
sp|A4QTQ9|UTP10_MAGO7 U3 small nucleolar RNA-associated protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UTP10 PE=3 SV=2 1 1804 0.0E+00
sp|Q0V1B1|UTP10_PHANO U3 small nucleolar RNA-associated protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=UTP10 PE=3 SV=2 186 1804 0.0E+00
sp|Q5B1X5|UTP10_EMENI U3 small nucleolar RNA-associated protein 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|A5AB61|UTP10_ASPNC U3 small nucleolar RNA-associated protein 10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|Q1DHH9|UTP10_COCIM U3 small nucleolar RNA-associated protein 10 OS=Coccidioides immitis (strain RS) GN=UTP10 PE=3 SV=2 1 1803 0.0E+00
sp|Q0CSG1|UTP10_ASPTN U3 small nucleolar RNA-associated protein 10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|A1DP58|UTP10_NEOFI U3 small nucleolar RNA-associated protein 10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|A1CUH7|UTP10_ASPCL U3 small nucleolar RNA-associated protein 10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|Q4WLI9|UTP10_ASPFU U3 small nucleolar RNA-associated protein 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|Q2ULC6|UTP10_ASPOR U3 small nucleolar RNA-associated protein 10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=utp10 PE=3 SV=1 1 1803 0.0E+00
sp|Q2HA26|UTP10_CHAGB U3 small nucleolar RNA-associated protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=UTP10 PE=3 SV=1 1 1804 0.0E+00
sp|Q6C457|UTP10_YARLI U3 small nucleolar RNA-associated protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UTP10 PE=3 SV=1 3 1803 8.0E-128
sp|Q59ZX6|UTP10_CANAL U3 small nucleolar RNA-associated protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTP10 PE=3 SV=1 3 1803 2.0E-116
sp|Q6BXQ6|UTP10_DEBHA U3 small nucleolar RNA-associated protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UTP10 PE=3 SV=2 3 1803 2.0E-102
sp|O60179|UTP10_SCHPO U3 small nucleolar RNA-associated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp10 PE=3 SV=1 576 1798 1.0E-88
sp|A3GGS6|UTP10_PICST U3 small nucleolar RNA-associated protein 10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UTP10 PE=3 SV=2 796 1803 3.0E-78
sp|Q6FT93|UTP10_CANGA U3 small nucleolar RNA-associated protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UTP10 PE=3 SV=1 776 1803 4.0E-66
sp|Q6CJ57|UTP10_KLULA U3 small nucleolar RNA-associated protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UTP10 PE=3 SV=1 999 1803 4.0E-66
sp|A5E212|UTP10_LODEL U3 small nucleolar RNA-associated protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UTP10 PE=3 SV=2 920 1803 3.0E-64
sp|A5DGZ7|UTP10_PICGU U3 small nucleolar RNA-associated protein 10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UTP10 PE=3 SV=2 923 1804 8.0E-61
sp|Q9GM44|HEAT1_MACFA HEAT repeat-containing protein 1 (Fragment) OS=Macaca fascicularis GN=HEATR1 PE=2 SV=2 924 1799 5.0E-56
sp|Q9H583|HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 924 1801 2.0E-54
sp|Q7SY48|HEAT1_DANRE HEAT repeat-containing protein 1 OS=Danio rerio GN=heatr1 PE=2 SV=1 911 1801 4.0E-42
sp|P42945|UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP10 PE=1 SV=1 3 646 4.0E-39
sp|P0CO15|UTP10_CRYNB U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UTP10 PE=3 SV=1 926 1796 4.0E-38
sp|P0CO14|UTP10_CRYNJ U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UTP10 PE=3 SV=1 926 1796 5.0E-38
sp|O60179|UTP10_SCHPO U3 small nucleolar RNA-associated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp10 PE=3 SV=1 1 440 5.0E-37
sp|Q6FT93|UTP10_CANGA U3 small nucleolar RNA-associated protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UTP10 PE=3 SV=1 3 645 9.0E-36
sp|A3GGS6|UTP10_PICST U3 small nucleolar RNA-associated protein 10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UTP10 PE=3 SV=2 3 320 6.0E-34
sp|A5DGZ7|UTP10_PICGU U3 small nucleolar RNA-associated protein 10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UTP10 PE=3 SV=2 4 323 3.0E-32
sp|Q6CJ57|UTP10_KLULA U3 small nucleolar RNA-associated protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UTP10 PE=3 SV=1 3 645 7.0E-32
sp|P42945|UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP10 PE=1 SV=1 1262 1803 9.0E-32
sp|A5E212|UTP10_LODEL U3 small nucleolar RNA-associated protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UTP10 PE=3 SV=2 3 276 9.0E-31
sp|P0CO14|UTP10_CRYNJ U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UTP10 PE=3 SV=1 3 364 2.0E-28
sp|Q754J8|UTP10_ASHGO U3 small nucleolar RNA-associated protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UTP10 PE=3 SV=1 3 278 2.0E-28
sp|P0CO15|UTP10_CRYNB U3 small nucleolar RNA-associated protein 10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UTP10 PE=3 SV=1 3 364 2.0E-28
sp|Q754J8|UTP10_ASHGO U3 small nucleolar RNA-associated protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UTP10 PE=3 SV=1 1262 1803 4.0E-28
sp|Q4P937|UTP10_USTMA U3 small nucleolar RNA-associated protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UTP10 PE=3 SV=1 562 1222 5.0E-26
sp|P42945|UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP10 PE=1 SV=1 999 1166 6.0E-26
sp|Q754J8|UTP10_ASHGO U3 small nucleolar RNA-associated protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UTP10 PE=3 SV=1 762 1166 3.0E-24
sp|Q0V1B1|UTP10_PHANO U3 small nucleolar RNA-associated protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=UTP10 PE=3 SV=2 1 117 1.0E-23
sp|Q54ML4|HEAT1_DICDI HEAT repeat-containing protein 1 homolog OS=Dictyostelium discoideum GN=heatr1 PE=3 SV=1 1 353 3.0E-23
sp|Q9C8Z4|HEAT1_ARATH Uncharacterized protein At3g06530 OS=Arabidopsis thaliana GN=At3g06530 PE=1 SV=3 1 383 9.0E-23
sp|Q9H583|HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 3 353 4.0E-22
sp|Q4P937|UTP10_USTMA U3 small nucleolar RNA-associated protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UTP10 PE=3 SV=1 1 222 2.0E-20
sp|Q7SY48|HEAT1_DANRE HEAT repeat-containing protein 1 OS=Danio rerio GN=heatr1 PE=2 SV=1 3 372 7.0E-20
sp|Q9VM75|HEAT1_DROME HEAT repeat-containing protein 1 homolog OS=Drosophila melanogaster GN=l(2)k09022 PE=2 SV=2 1 224 2.0E-16
sp|Q9VM75|HEAT1_DROME HEAT repeat-containing protein 1 homolog OS=Drosophila melanogaster GN=l(2)k09022 PE=2 SV=2 1534 1803 1.0E-15
sp|Q9VM75|HEAT1_DROME HEAT repeat-containing protein 1 homolog OS=Drosophila melanogaster GN=l(2)k09022 PE=2 SV=2 901 1173 2.0E-15
sp|Q9C8Z4|HEAT1_ARATH Uncharacterized protein At3g06530 OS=Arabidopsis thaliana GN=At3g06530 PE=1 SV=3 1550 1799 2.0E-13
sp|Q4P937|UTP10_USTMA U3 small nucleolar RNA-associated protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UTP10 PE=3 SV=1 1517 1803 5.0E-13
sp|Q54ML4|HEAT1_DICDI HEAT repeat-containing protein 1 homolog OS=Dictyostelium discoideum GN=heatr1 PE=3 SV=1 1268 1607 6.0E-11
sp|Q54ML4|HEAT1_DICDI HEAT repeat-containing protein 1 homolog OS=Dictyostelium discoideum GN=heatr1 PE=3 SV=1 1659 1803 2.0E-10
sp|Q23495|HEAT1_CAEEL HEAT repeat-containing protein 1 homolog OS=Caenorhabditis elegans GN=toe-1 PE=3 SV=1 1 172 2.0E-10
sp|Q23495|HEAT1_CAEEL HEAT repeat-containing protein 1 homolog OS=Caenorhabditis elegans GN=toe-1 PE=3 SV=1 924 1103 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3602
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4927 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|765
Ophiocordyceps camponoti-floridani Ophcf2|05096
Ophiocordyceps camponoti-rufipedis Ophun1|3271
Ophiocordyceps kimflemingae Ophio5|3227
Ophiocordyceps subramaniannii Hirsu2|6946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4927
MASSLASQLAQIAANSKATLNTKAQKAAHSKSLIWEPKAAACQSYQALYTICYSGFEELCQLDARFLHFQSTIFS
QASQDQDRTLLTSAENVQLDRQIDTFLRLAGSRLRLMPAIKAIEWLVRRFRIHENNTAMLLMTFLPYHSIPTFAT
LMSILPSRIPHEFRFLDPYIRSLRCPPRSILVHEAVHHPAFLSAVSEYTLESCRQQSQYSALITFWGGLMTETLS
GIIDRTRSGRATVQSENTQALIHRIGPVLGESLVMKKIPSIQIASYMVLAVFVFKAHLDDAAVTAFMEQTVHGWT
QETVRPGLICLAIMAQFRSGKQMSNKITKALMKISNIGALLVEIGQERRIDKLANGLCLALIERLTKKSDSRGLP
TILAVLESQILEEKQITVIFKSLLLTALKLDDDNDEAGKLRRDLGSVLITLSQTSGKSGDIIQSVIEKTDFDIEQ
LEMKLDLSFRQRKLPDAAESSNSDMASQTVDESQGKHGKQDLLAAVDELSNHKESLATCLQTRPNALFDEFSHLF
FSIVSEQSSSSEAHDRFDRSSKMRRRSAAKECTYCSFYIRIWCGPYPALARMAAINLVKERLKSEKDETVDFQAL
IPYCLTALSDPSKRVRQATADLMTVLADRYASLNTFKSMTIWGAGALYGKKKNFTSMDSIIAAKMICLQILPSIE
ECIMDPQHIYTVMGTIIQYGKYQVFDAAMDQKDHLSQSARLAVLKSLGSHAAATPFLLVKDRLLKGISEARGVGS
TSRTQVLLPVLQWWASLTEDDTLSLCQLERIDRKELDLRLVNVVVANDAAGLEYLLEILNDGGKREKDSLMEAIF
CRLKKMWQGMKSEVKSMVAKQLLDMSQEQTAENGSESIVPGEAADMLRNVELTTDILSFFLESMRSGTKMIGEAY
PEKNNSAIASTASKVSPETSQALRRFTFVLQLVEESDPVTHPELLDGLFTALSELQQYKTLASSELGYLENLILR
SLLAIMPAYKGDRPLKTTNSSSYGDLLVNCIQSSSSPVVQNSALLLIADLAATAPNLVLHSVMPIFTFMGASVLR
QSDDYSAHVVFQTIKEVIPPLIKSLRQGKKSPVAGASDILLSFATAYAHMPAHRRLGMFITLVETLGAREFLFAL
VGMMVDKYDTSDALLQFLVEVMSHVDIETQLDTLGKLVDVIADLLKAKPGISLAIFGIGKQDQKEEVDKVALRQL
SALPYLLSSKALKGEFDKLADHDDMEASQVRRLYSALLQKILLLADTVKDKQALHVKCGVTLSHLLNLLSIGEFI
KAVESLLDRQEMGLRHKVLRALEVRVATEDKTDTRARQVLLGFLPQLTAAIRDSSSIWDKHTAVTCVDKIAEKYG
KMDVEVVVAAAETIAGESCLGQEDGRLRVMALLCLTSLVDALQDGIVPVLPIAIPKAMGYLESSIEGNEVDEDLH
SACFGFLSSMAQHVGYMLSSYSDRLLKVCDKSAEAGLSDDANSSRVGCLGIMAKRLDANDLLTSLKGNWENSVRL
GLGAVSEKLDMVGMVIDKQAKSKVAKFAPLLLSILLEGFDMRRQLHSTGRHDERTMRQLDKVEASTSEKALKMVY
KLNDAAFRPIFVEMMEWTGTGAAGQERRSRIDRKWPMYGFFLTFFQQLKSIVSSYASYIVDDAVKILGSADMEDE
FEKALWRRVVKTLATCFEHDQDEFWQAPAHFEAVAPSVADQLLRAEAVDVTEEVVPAVVELAAAADSQKHQRDLN
GRLMRHVQSSRREVRVAAVKCQQALTERLGEEWLSMLHEMLPRISELQEDHDEEVEKETHRWIVKIEGVLGESLD
AMLQ*
Coding >OphauG2|4927
ATGGCAAGCTCTCTAGCTTCACAGCTAGCGCAAATTGCCGCCAATTCAAAAGCGACTCTCAATACAAAGGCGCAA
AAAGCTGCTCATTCAAAATCTCTTATTTGGGAGCCCAAGGCCGCTGCATGCCAGAGCTACCAGGCACTCTACACC
ATCTGTTACTCGGGGTTCGAGGAGCTTTGCCAGCTTGATGCTAGATTTTTGCATTTCCAGTCCACAATTTTTAGC
CAAGCCAGCCAAGACCAAGACCGCACTCTTCTTACATCTGCCGAAAATGTCCAACTTGATCGCCAAATCGACACT
TTCTTGCGCCTCGCTGGGAGCCGACTGCGCCTCATGCCAGCTATCAAGGCCATAGAGTGGCTTGTTCGCCGCTTT
AGGATTCACGAGAATAACACTGCGATGCTGCTCATGACATTTCTCCCTTACCACTCTATACCCACGTTTGCGACG
CTCATGTCGATTCTCCCGTCTCGGATACCCCACGAATTTCGGTTCCTCGACCCTTATATCCGCTCTCTCAGGTGC
CCGCCAAGATCTATCCTAGTCCACGAGGCTGTTCATCACCCCGCATTTCTTTCTGCTGTATCGGAATACACACTC
GAATCATGCCGTCAACAATCCCAATATTCAGCCCTCATTACTTTCTGGGGCGGCTTAATGACAGAAACCTTGAGC
GGAATCATTGATCGGACAAGATCAGGCCGAGCCACAGTACAGAGCGAAAACACTCAGGCTCTAATCCACAGAATC
GGCCCAGTATTGGGCGAGTCATTGGTTATGAAGAAAATTCCTAGCATCCAAATCGCTTCTTACATGGTTCTGGCC
GTCTTTGTGTTCAAGGCACATCTAGACGATGCTGCTGTTACCGCCTTTATGGAACAAACGGTCCATGGCTGGACC
CAAGAGACCGTAAGACCCGGCCTGATATGTCTCGCAATCATGGCACAGTTTAGGTCGGGCAAGCAAATGAGCAAC
AAGATCACCAAGGCTCTCATGAAGATCTCCAATATTGGCGCGCTTCTTGTTGAAATTGGCCAGGAGAGACGTATT
GATAAACTGGCCAATGGCCTTTGCCTAGCTCTGATTGAGAGACTGACAAAAAAGAGCGACTCACGTGGCCTACCT
ACCATTTTGGCAGTTCTAGAGAGCCAAATATTGGAGGAGAAACAAATCACAGTCATCTTCAAGTCGCTTCTTCTA
ACTGCTTTGAAGCTCGATGATGACAATGACGAAGCTGGGAAACTCCGGAGAGACCTTGGATCCGTCCTCATTACT
CTCTCGCAAACAAGTGGGAAATCGGGCGACATTATCCAATCCGTGATTGAAAAAACCGACTTTGATATTGAGCAG
CTCGAAATGAAGCTTGATCTTTCCTTTCGCCAAAGAAAGCTGCCCGACGCGGCTGAAAGCTCGAACAGCGATATG
GCATCACAGACTGTGGATGAGTCACAGGGCAAGCATGGAAAGCAGGACCTTTTGGCTGCCGTTGACGAGTTATCC
AACCACAAAGAGTCACTTGCTACATGCCTACAAACGCGGCCCAATGCTCTATTCGACGAGTTCAGCCATTTATTT
TTTTCCATTGTGTCGGAGCAGTCCAGTAGTTCCGAGGCACATGATAGGTTTGACCGCAGCTCCAAGATGCGACGC
CGGTCGGCTGCCAAAGAATGCACTTATTGCAGCTTCTATATACGGATCTGGTGCGGTCCCTACCCAGCCCTGGCC
CGCATGGCTGCCATAAATCTGGTCAAGGAAAGACTCAAGTCGGAAAAGGATGAAACAGTAGACTTTCAGGCCTTG
ATACCTTATTGTCTGACGGCGCTTAGTGACCCATCGAAGCGAGTGCGCCAAGCAACAGCAGACTTGATGACGGTA
CTCGCGGATCGCTACGCCTCCTTGAATACATTCAAGTCAATGACCATTTGGGGCGCTGGAGCCTTGTACGGAAAA
AAGAAGAATTTTACAAGCATGGACTCGATAATAGCGGCAAAGATGATTTGCCTGCAAATCCTTCCGAGCATAGAG
GAATGCATCATGGATCCACAGCACATATATACAGTCATGGGGACCATTATTCAATACGGCAAATACCAAGTATTT
GACGCTGCTATGGACCAGAAAGACCACCTTTCACAATCGGCAAGACTTGCCGTCCTAAAAAGCCTGGGTTCACAT
GCGGCTGCAACACCATTTTTGCTTGTCAAGGATCGGCTGCTAAAGGGAATCAGCGAGGCACGGGGCGTTGGTAGC
ACATCTCGCACACAAGTGCTCCTACCTGTCTTGCAGTGGTGGGCAAGCTTGACCGAAGACGACACTCTGTCGCTG
TGCCAACTGGAGCGAATTGATAGAAAGGAACTCGACTTGCGTCTGGTGAATGTTGTAGTAGCCAATGATGCTGCA
GGTCTTGAATACCTGCTCGAGATATTAAACGATGGAGGGAAACGCGAAAAGGACTCTTTGATGGAGGCGATATTC
TGTCGCCTAAAAAAAATGTGGCAGGGCATGAAGAGCGAGGTCAAATCCATGGTTGCTAAGCAGCTCCTGGACATG
TCCCAAGAGCAAACAGCAGAGAATGGCTCTGAATCCATTGTGCCTGGCGAGGCTGCTGATATGCTTAGAAACGTG
GAGCTTACCACCGACATTTTGTCATTCTTCTTGGAGTCGATGCGAAGCGGCACCAAGATGATTGGCGAGGCTTAT
CCCGAAAAGAACAACAGTGCCATTGCTTCCACGGCCAGCAAGGTCAGCCCAGAAACAAGCCAAGCTTTGCGCCGC
TTCACGTTTGTGCTGCAACTCGTCGAGGAATCAGACCCGGTCACACACCCCGAACTTCTGGACGGCTTGTTCACC
GCTCTGTCTGAGCTTCAGCAGTATAAAACGCTGGCCAGCTCGGAGCTTGGCTACCTAGAGAATTTGATCCTGCGC
AGTCTGTTGGCCATCATGCCGGCTTACAAGGGGGACAGGCCACTCAAGACGACAAACTCGAGCAGCTATGGAGAC
TTGCTTGTCAACTGTATTCAATCATCATCGAGTCCTGTTGTTCAAAACTCGGCACTGCTTCTGATTGCTGATTTG
GCGGCAACGGCACCCAACCTGGTGCTGCACAGTGTCATGCCAATCTTTACATTCATGGGAGCATCTGTGCTTCGG
CAGAGCGACGACTACTCGGCGCACGTTGTCTTTCAAACCATCAAGGAAGTCATACCGCCGCTTATCAAATCGCTA
AGGCAGGGCAAGAAGAGCCCCGTGGCTGGCGCAAGTGACATACTGCTGAGTTTTGCGACGGCATACGCACACATG
CCGGCACACCGCAGACTTGGCATGTTTATCACCTTGGTGGAAACGCTGGGTGCTCGCGAGTTTCTCTTTGCTCTG
GTTGGGATGATGGTGGACAAGTACGATACCAGTGATGCTCTGTTGCAGTTTCTCGTGGAAGTCATGAGCCATGTC
GACATTGAGACGCAACTCGACACCCTGGGCAAGCTTGTAGATGTGATTGCCGATCTGCTCAAGGCGAAGCCCGGT
ATATCTCTAGCCATCTTTGGCATTGGAAAGCAGGACCAAAAAGAGGAGGTGGACAAGGTTGCTCTGCGCCAACTA
TCAGCGTTGCCCTACTTGCTCTCGAGCAAGGCACTCAAGGGAGAGTTTGACAAGCTGGCCGACCACGATGACATG
GAGGCTTCACAAGTCAGAAGGCTCTATTCGGCCCTGCTGCAAAAGATTCTCCTCTTGGCCGATACAGTAAAGGAC
AAGCAGGCACTACATGTAAAGTGCGGGGTGACGCTGTCTCATTTGCTCAATCTCTTGTCGATTGGAGAGTTCATC
AAGGCTGTGGAGAGCTTGCTGGACAGACAAGAAATGGGTCTCCGACACAAGGTGCTGCGGGCACTAGAGGTTCGC
GTAGCGACCGAGGACAAGACGGACACAAGAGCTCGGCAAGTGTTGCTCGGATTTCTGCCACAGCTGACGGCGGCG
ATTCGCGACTCGAGCAGCATTTGGGACAAGCACACTGCGGTGACATGCGTGGACAAGATTGCGGAAAAGTACGGC
AAAATGGATGTTGAGGTGGTTGTGGCAGCGGCAGAAACGATTGCGGGAGAGTCTTGTCTGGGCCAAGAAGATGGA
CGGCTCCGTGTCATGGCGCTTCTTTGTCTCACGTCGCTGGTGGACGCGCTACAAGATGGCATTGTGCCTGTGCTC
CCGATTGCAATTCCAAAGGCCATGGGATATCTTGAATCAAGCATCGAGGGCAACGAAGTTGACGAGGATCTTCAT
TCTGCCTGCTTTGGATTCCTGAGCTCCATGGCACAACATGTTGGCTACATGCTTTCCAGCTATAGCGACAGATTG
CTCAAGGTGTGCGACAAGTCGGCTGAGGCAGGACTGAGCGACGACGCAAATAGTAGCCGGGTTGGGTGTCTGGGC
ATCATGGCCAAGCGGCTGGATGCAAATGACTTGTTGACGAGCTTGAAGGGCAACTGGGAGAATAGCGTGAGGCTG
GGACTAGGGGCTGTGTCTGAGAAGCTCGACATGGTGGGCATGGTGATTGATAAGCAGGCAAAGTCCAAGGTTGCA
AAATTTGCGCCTTTGCTCTTGTCGATTCTCCTGGAAGGGTTTGACATGCGACGACAGCTGCACAGCACAGGGCGC
CATGATGAAAGGACAATGCGGCAACTGGACAAGGTAGAGGCGAGCACGAGCGAAAAGGCGCTCAAGATGGTTTAC
AAGCTCAATGATGCAGCGTTCCGGCCGATTTTTGTGGAAATGATGGAATGGACGGGGACGGGAGCAGCAGGACAG
GAGAGAAGAAGTCGGATTGATAGGAAATGGCCCATGTATGGCTTCTTTCTGACCTTTTTCCAACAGCTCAAGTCG
ATTGTGAGCAGCTACGCAAGCTACATTGTTGACGACGCGGTCAAGATCTTGGGCAGCGCGGACATGGAGGACGAG
TTTGAAAAGGCGCTGTGGAGGCGGGTGGTGAAGACGCTGGCGACGTGTTTTGAGCACGACCAAGACGAATTCTGG
CAGGCGCCGGCGCATTTCGAGGCTGTGGCTCCCAGCGTGGCAGACCAGCTGCTCCGGGCCGAGGCGGTGGATGTG
ACGGAGGAGGTGGTGCCGGCCGTGGTGGAGCTGGCGGCAGCAGCCGACTCACAAAAGCACCAGCGCGATCTCAAT
GGGCGGCTCATGAGGCATGTGCAGTCGTCGCGGCGAGAGGTTCGGGTGGCGGCAGTCAAGTGTCAGCAGGCATTG
ACGGAGCGGCTGGGGGAGGAGTGGCTGTCTATGCTGCATGAGATGCTGCCGCGCATCAGCGAGCTGCAAGAGGAC
CATGATGAAGAGGTGGAAAAGGAGACGCATCGGTGGATTGTCAAGATTGAGGGGGTGCTGGGGGAGAGTCTGGAT
GCCATGTTGCAGTAG
Transcript >OphauG2|4927
ATGGCAAGCTCTCTAGCTTCACAGCTAGCGCAAATTGCCGCCAATTCAAAAGCGACTCTCAATACAAAGGCGCAA
AAAGCTGCTCATTCAAAATCTCTTATTTGGGAGCCCAAGGCCGCTGCATGCCAGAGCTACCAGGCACTCTACACC
ATCTGTTACTCGGGGTTCGAGGAGCTTTGCCAGCTTGATGCTAGATTTTTGCATTTCCAGTCCACAATTTTTAGC
CAAGCCAGCCAAGACCAAGACCGCACTCTTCTTACATCTGCCGAAAATGTCCAACTTGATCGCCAAATCGACACT
TTCTTGCGCCTCGCTGGGAGCCGACTGCGCCTCATGCCAGCTATCAAGGCCATAGAGTGGCTTGTTCGCCGCTTT
AGGATTCACGAGAATAACACTGCGATGCTGCTCATGACATTTCTCCCTTACCACTCTATACCCACGTTTGCGACG
CTCATGTCGATTCTCCCGTCTCGGATACCCCACGAATTTCGGTTCCTCGACCCTTATATCCGCTCTCTCAGGTGC
CCGCCAAGATCTATCCTAGTCCACGAGGCTGTTCATCACCCCGCATTTCTTTCTGCTGTATCGGAATACACACTC
GAATCATGCCGTCAACAATCCCAATATTCAGCCCTCATTACTTTCTGGGGCGGCTTAATGACAGAAACCTTGAGC
GGAATCATTGATCGGACAAGATCAGGCCGAGCCACAGTACAGAGCGAAAACACTCAGGCTCTAATCCACAGAATC
GGCCCAGTATTGGGCGAGTCATTGGTTATGAAGAAAATTCCTAGCATCCAAATCGCTTCTTACATGGTTCTGGCC
GTCTTTGTGTTCAAGGCACATCTAGACGATGCTGCTGTTACCGCCTTTATGGAACAAACGGTCCATGGCTGGACC
CAAGAGACCGTAAGACCCGGCCTGATATGTCTCGCAATCATGGCACAGTTTAGGTCGGGCAAGCAAATGAGCAAC
AAGATCACCAAGGCTCTCATGAAGATCTCCAATATTGGCGCGCTTCTTGTTGAAATTGGCCAGGAGAGACGTATT
GATAAACTGGCCAATGGCCTTTGCCTAGCTCTGATTGAGAGACTGACAAAAAAGAGCGACTCACGTGGCCTACCT
ACCATTTTGGCAGTTCTAGAGAGCCAAATATTGGAGGAGAAACAAATCACAGTCATCTTCAAGTCGCTTCTTCTA
ACTGCTTTGAAGCTCGATGATGACAATGACGAAGCTGGGAAACTCCGGAGAGACCTTGGATCCGTCCTCATTACT
CTCTCGCAAACAAGTGGGAAATCGGGCGACATTATCCAATCCGTGATTGAAAAAACCGACTTTGATATTGAGCAG
CTCGAAATGAAGCTTGATCTTTCCTTTCGCCAAAGAAAGCTGCCCGACGCGGCTGAAAGCTCGAACAGCGATATG
GCATCACAGACTGTGGATGAGTCACAGGGCAAGCATGGAAAGCAGGACCTTTTGGCTGCCGTTGACGAGTTATCC
AACCACAAAGAGTCACTTGCTACATGCCTACAAACGCGGCCCAATGCTCTATTCGACGAGTTCAGCCATTTATTT
TTTTCCATTGTGTCGGAGCAGTCCAGTAGTTCCGAGGCACATGATAGGTTTGACCGCAGCTCCAAGATGCGACGC
CGGTCGGCTGCCAAAGAATGCACTTATTGCAGCTTCTATATACGGATCTGGTGCGGTCCCTACCCAGCCCTGGCC
CGCATGGCTGCCATAAATCTGGTCAAGGAAAGACTCAAGTCGGAAAAGGATGAAACAGTAGACTTTCAGGCCTTG
ATACCTTATTGTCTGACGGCGCTTAGTGACCCATCGAAGCGAGTGCGCCAAGCAACAGCAGACTTGATGACGGTA
CTCGCGGATCGCTACGCCTCCTTGAATACATTCAAGTCAATGACCATTTGGGGCGCTGGAGCCTTGTACGGAAAA
AAGAAGAATTTTACAAGCATGGACTCGATAATAGCGGCAAAGATGATTTGCCTGCAAATCCTTCCGAGCATAGAG
GAATGCATCATGGATCCACAGCACATATATACAGTCATGGGGACCATTATTCAATACGGCAAATACCAAGTATTT
GACGCTGCTATGGACCAGAAAGACCACCTTTCACAATCGGCAAGACTTGCCGTCCTAAAAAGCCTGGGTTCACAT
GCGGCTGCAACACCATTTTTGCTTGTCAAGGATCGGCTGCTAAAGGGAATCAGCGAGGCACGGGGCGTTGGTAGC
ACATCTCGCACACAAGTGCTCCTACCTGTCTTGCAGTGGTGGGCAAGCTTGACCGAAGACGACACTCTGTCGCTG
TGCCAACTGGAGCGAATTGATAGAAAGGAACTCGACTTGCGTCTGGTGAATGTTGTAGTAGCCAATGATGCTGCA
GGTCTTGAATACCTGCTCGAGATATTAAACGATGGAGGGAAACGCGAAAAGGACTCTTTGATGGAGGCGATATTC
TGTCGCCTAAAAAAAATGTGGCAGGGCATGAAGAGCGAGGTCAAATCCATGGTTGCTAAGCAGCTCCTGGACATG
TCCCAAGAGCAAACAGCAGAGAATGGCTCTGAATCCATTGTGCCTGGCGAGGCTGCTGATATGCTTAGAAACGTG
GAGCTTACCACCGACATTTTGTCATTCTTCTTGGAGTCGATGCGAAGCGGCACCAAGATGATTGGCGAGGCTTAT
CCCGAAAAGAACAACAGTGCCATTGCTTCCACGGCCAGCAAGGTCAGCCCAGAAACAAGCCAAGCTTTGCGCCGC
TTCACGTTTGTGCTGCAACTCGTCGAGGAATCAGACCCGGTCACACACCCCGAACTTCTGGACGGCTTGTTCACC
GCTCTGTCTGAGCTTCAGCAGTATAAAACGCTGGCCAGCTCGGAGCTTGGCTACCTAGAGAATTTGATCCTGCGC
AGTCTGTTGGCCATCATGCCGGCTTACAAGGGGGACAGGCCACTCAAGACGACAAACTCGAGCAGCTATGGAGAC
TTGCTTGTCAACTGTATTCAATCATCATCGAGTCCTGTTGTTCAAAACTCGGCACTGCTTCTGATTGCTGATTTG
GCGGCAACGGCACCCAACCTGGTGCTGCACAGTGTCATGCCAATCTTTACATTCATGGGAGCATCTGTGCTTCGG
CAGAGCGACGACTACTCGGCGCACGTTGTCTTTCAAACCATCAAGGAAGTCATACCGCCGCTTATCAAATCGCTA
AGGCAGGGCAAGAAGAGCCCCGTGGCTGGCGCAAGTGACATACTGCTGAGTTTTGCGACGGCATACGCACACATG
CCGGCACACCGCAGACTTGGCATGTTTATCACCTTGGTGGAAACGCTGGGTGCTCGCGAGTTTCTCTTTGCTCTG
GTTGGGATGATGGTGGACAAGTACGATACCAGTGATGCTCTGTTGCAGTTTCTCGTGGAAGTCATGAGCCATGTC
GACATTGAGACGCAACTCGACACCCTGGGCAAGCTTGTAGATGTGATTGCCGATCTGCTCAAGGCGAAGCCCGGT
ATATCTCTAGCCATCTTTGGCATTGGAAAGCAGGACCAAAAAGAGGAGGTGGACAAGGTTGCTCTGCGCCAACTA
TCAGCGTTGCCCTACTTGCTCTCGAGCAAGGCACTCAAGGGAGAGTTTGACAAGCTGGCCGACCACGATGACATG
GAGGCTTCACAAGTCAGAAGGCTCTATTCGGCCCTGCTGCAAAAGATTCTCCTCTTGGCCGATACAGTAAAGGAC
AAGCAGGCACTACATGTAAAGTGCGGGGTGACGCTGTCTCATTTGCTCAATCTCTTGTCGATTGGAGAGTTCATC
AAGGCTGTGGAGAGCTTGCTGGACAGACAAGAAATGGGTCTCCGACACAAGGTGCTGCGGGCACTAGAGGTTCGC
GTAGCGACCGAGGACAAGACGGACACAAGAGCTCGGCAAGTGTTGCTCGGATTTCTGCCACAGCTGACGGCGGCG
ATTCGCGACTCGAGCAGCATTTGGGACAAGCACACTGCGGTGACATGCGTGGACAAGATTGCGGAAAAGTACGGC
AAAATGGATGTTGAGGTGGTTGTGGCAGCGGCAGAAACGATTGCGGGAGAGTCTTGTCTGGGCCAAGAAGATGGA
CGGCTCCGTGTCATGGCGCTTCTTTGTCTCACGTCGCTGGTGGACGCGCTACAAGATGGCATTGTGCCTGTGCTC
CCGATTGCAATTCCAAAGGCCATGGGATATCTTGAATCAAGCATCGAGGGCAACGAAGTTGACGAGGATCTTCAT
TCTGCCTGCTTTGGATTCCTGAGCTCCATGGCACAACATGTTGGCTACATGCTTTCCAGCTATAGCGACAGATTG
CTCAAGGTGTGCGACAAGTCGGCTGAGGCAGGACTGAGCGACGACGCAAATAGTAGCCGGGTTGGGTGTCTGGGC
ATCATGGCCAAGCGGCTGGATGCAAATGACTTGTTGACGAGCTTGAAGGGCAACTGGGAGAATAGCGTGAGGCTG
GGACTAGGGGCTGTGTCTGAGAAGCTCGACATGGTGGGCATGGTGATTGATAAGCAGGCAAAGTCCAAGGTTGCA
AAATTTGCGCCTTTGCTCTTGTCGATTCTCCTGGAAGGGTTTGACATGCGACGACAGCTGCACAGCACAGGGCGC
CATGATGAAAGGACAATGCGGCAACTGGACAAGGTAGAGGCGAGCACGAGCGAAAAGGCGCTCAAGATGGTTTAC
AAGCTCAATGATGCAGCGTTCCGGCCGATTTTTGTGGAAATGATGGAATGGACGGGGACGGGAGCAGCAGGACAG
GAGAGAAGAAGTCGGATTGATAGGAAATGGCCCATGTATGGCTTCTTTCTGACCTTTTTCCAACAGCTCAAGTCG
ATTGTGAGCAGCTACGCAAGCTACATTGTTGACGACGCGGTCAAGATCTTGGGCAGCGCGGACATGGAGGACGAG
TTTGAAAAGGCGCTGTGGAGGCGGGTGGTGAAGACGCTGGCGACGTGTTTTGAGCACGACCAAGACGAATTCTGG
CAGGCGCCGGCGCATTTCGAGGCTGTGGCTCCCAGCGTGGCAGACCAGCTGCTCCGGGCCGAGGCGGTGGATGTG
ACGGAGGAGGTGGTGCCGGCCGTGGTGGAGCTGGCGGCAGCAGCCGACTCACAAAAGCACCAGCGCGATCTCAAT
GGGCGGCTCATGAGGCATGTGCAGTCGTCGCGGCGAGAGGTTCGGGTGGCGGCAGTCAAGTGTCAGCAGGCATTG
ACGGAGCGGCTGGGGGAGGAGTGGCTGTCTATGCTGCATGAGATGCTGCCGCGCATCAGCGAGCTGCAAGAGGAC
CATGATGAAGAGGTGGAAAAGGAGACGCATCGGTGGATTGTCAAGATTGAGGGGGTGCTGGGGGAGAGTCTGGAT
GCCATGTTGCAGTAG
Gene >OphauG2|4927
ATGGCAAGCTCTCTAGCTTCACAGCTAGCGCAAATTGCCGCCAATTCAAAAGCGACTCTCAATACAAAGGCGCAA
AAAGCTGCTCATTCAAAATCTCTTATTTGGGAGCCCAAGGCCGCTGCATGCCAGAGCTACCAGGCACTCTACACC
ATCTGTTACTCGGGGTTCGAGGAGCTTTGCCAGCTTGATGCTAGATTTTTGCATTTCCAGTCCACAATTTTTAGC
CAAGCCAGCCAAGACCAAGACCGCACTCTTCTTACATCTGCCGAAAATGTCCAACTTGATCGCCAAATCGACACT
TTCTTGCGCCTCGCTGGGAGCCGACTGCGCCTCATGCCAGCTATCAAGGCCATAGAGTGGCTTGTTCGCCGCTTT
AGGTTGGTGCTCAGTCATTAGCATGTTCCAAGTTTGAGCTCGGCCAACTGACAGCGGGACAGGATTCACGAGAAT
AACACTGCGATGCTGCTCATGACATTTCTCCCTTACCACTCTATACCCACGTTTGCGACGCTCATGTCGATTCTC
CCGTCTCGGATACCCCACGAATTTCGGTTCCTCGACCCTTATATCCGCTCTCTCAGGTGCCCGCCAAGATCTATC
CTAGTCCACGAGGCTGTTCATCACCCCGCATTTCTTTCTGCTGTATCGGAATACACACTCGAATCATGCCGTCAA
CAATCCCAATATTCAGCCCTCATTACTTTCTGGGGCGGCTTAATGACAGAAACCTTGAGCGGAATCATTGATCGG
ACAAGATCAGGCCGAGCCACAGTACAGAGCGAAAACACTCAGGCTCTAATCCACAGAATCGGCCCAGTATTGGGC
GAGTCATTGGTTATGAAGAAAATTCCTAGCATCCAAATCGCTTCTTACATGGTTCTGGCCGTCTTTGTGTTCAAG
GCACATCTAGACGATGCTGCTGTTACCGCCTTTATGGAACAAACGGTCCATGGCTGGACCCAAGAGACCGTAAGA
CCCGGCCTGATATGTCTCGCAATCATGGCACAGTTTAGGTCGGGCAAGCAAATGAGCAACAAGATCACCAAGGCT
CTCATGAAGATCTCCAATATTGGCGCGCTTCTTGTTGAAATTGGCCAGGAGAGACGTATTGATAAACTGGCCAAT
GGCCTTTGCCTAGCTCTGATTGAGAGACTGACAAAAAAGAGCGACTCACGTGGCCTACCTACCATTTTGGCAGTT
CTAGAGAGCCAAATATTGGAGGAGAAACAAATCACAGTCATCTTCAAGTCGCTTCTTCTAACTGCTTTGAAGCTC
GATGATGACAATGACGAAGCTGGGAAACTCCGGAGAGACCTTGGATCCGTCCTCATTACTCTCTCGCAAACAAGT
GGGAAATCGGGCGACATTATCCAATCCGTGATTGAAAAAACCGACTTTGATATTGAGCAGCTCGAAATGAAGCTT
GATCTTTCCTTTCGCCAAAGAAAGCTGCCCGACGCGGCTGAAAGCTCGAACAGCGATATGGCATCACAGACTGTG
GATGAGTCACAGGGCAAGCATGGAAAGCAGGACCTTTTGGCTGCCGTTGACGAGTTATCCAACCACAAAGAGTCA
CTTGCTACATGCCTACAAACGCGGCCCAATGCTCTATTCGACGAGTTCAGCCATTTATTTTTTTCCATTGTGTCG
GAGCAGTCCAGTAGTTCCGAGGCACATGATAGGTTTGACCGCAGCTCCAAGATGCGACGCCGGTCGGCTGCCAAA
GAATGCACTTATTGCAGCTTCTATATACGGATCTGGTGCGGTCCCTACCCAGCCCTGGCCCGCATGGCTGCCATA
AATCTGGTCAAGGAAAGACTCAAGTCGGAAAAGGATGAAACAGTAGACTTTCAGGCCTTGATACCTTATTGTCTG
ACGGCGCTTAGTGACCCATCGAAGCGAGTGCGCCAAGCAACAGCAGACTTGATGACGGTACTCGCGGATCGCTAC
GCCTCCTTGAATACATTCAAGTCAATGACCATTTGGGGCGCTGGAGCCTTGTACGGAAAAAAGAAGAATTTTACA
AGCATGGACTCGATAATAGCGGCAAAGATGATTTGCCTGCAAATCCTTCCGAGCATAGAGGAATGCATCATGGAT
CCACAGCACATATATACAGTCATGGGGACCATTATTCAATACGGCAAATACCAAGTATTTGACGCTGCTATGGAC
CAGAAAGACCACCTTTCACAATCGGCAAGACTTGCCGTCCTAAAAAGCCTGGGTTCACATGCGGCTGCAACACCA
TTTTTGCTTGTCAAGGATCGGCTGCTAAAGGGAATCAGCGAGGCACGGGGCGTTGGTAGCACATCTCGCACACAA
GTGCTCCTACCTGTCTTGCAGTGGTGGGCAAGCTTGACCGAAGACGACACTCTGTCGCTGTGCCAACTGGAGCGA
ATTGATAGAAAGGAACTCGACTTGCGTCTGGTGAATGTTGTAGTAGCCAATGATGCTGCAGGTCTTGAATACCTG
CTCGAGATATTAAACGATGGAGGGAAACGCGAAAAGGACTCTTTGATGGAGGCGATATTCTGTCGCCTAAAAAAA
ATGTGGCAGGGCATGAAGAGCGAGGTCAAATCCATGGTTGCTAAGCAGCTCCTGGACATGTCCCAAGAGCAAACA
GCAGAGAATGGCTCTGAATCCATTGTGCCTGGCGAGGCTGCTGATATGCTTAGAAACGTGGAGCTTACCACCGAC
ATTTTGTCATTCTTCTTGGAGTCGATGCGAAGCGGCACCAAGATGATTGGCGAGGCTTATCCCGAAAAGAACAAC
AGTGCCATTGCTTCCACGGCCAGCAAGGTCAGCCCAGAAACAAGCCAAGCTTTGCGCCGCTTCACGTTTGTGCTG
CAACTCGTCGAGGAATCAGACCCGGTCACACACCCCGAACTTCTGGACGGCTTGTTCACCGCTCTGTCTGAGCTT
CAGCAGTATAAAACGCTGGCCAGCTCGGAGCTTGGCTACCTAGAGAATTTGATCCTGCGCAGTCTGTTGGCCATC
ATGCCGGCTTACAAGGGGGACAGGCCACTCAAGACGACAAACTCGAGCAGCTATGGAGACTTGCTTGTCAACTGT
ATTCAATCATCATCGAGTCCTGTTGTTCAAAACTCGGCACTGCTTCTGATTGCTGATTTGGCGGCAACGGCACCC
AACCTGGTGCTGCACAGTGTCATGCCAATCTTTACATTCATGGGAGCATCTGTGCTTCGGCAGAGCGACGACTAC
TCGGCGCACGTTGTCTTTCAAACCATCAAGGAAGTCATACCGCCGCTTATCAAATCGCTAAGGCAGGGCAAGAAG
AGCCCCGTGGCTGGCGCAAGTGACATACTGCTGAGTTTTGCGACGGCATACGCACACATGCCGGCACACCGCAGA
CTTGGCATGTTTATCACCTTGGTGGAAACGCTGGGTGCTCGCGAGTTTCTCTTTGCTCTGGTTGGGATGATGGTG
GACAAGTACGATACCAGTGATGCTCTGTTGCAGTTTCTCGTGGAAGTCATGAGCCATGTCGACATTGAGACGCAA
CTCGACACCCTGGGCAAGCTTGTAGATGTGATTGCCGATCTGCTCAAGGCGAAGCCCGGTATATCTCTAGCCATC
TTTGGCATTGGAAAGCAGGACCAAAAAGAGGAGGTGGACAAGGTTGCTCTGCGCCAACTATCAGCGTTGCCCTAC
TTGCTCTCGAGCAAGGCACTCAAGGGAGAGTTTGACAAGCTGGCCGACCACGATGACATGGAGGCTTCACAAGTC
AGAAGGCTCTATTCGGCCCTGCTGCAAAAGATTCTCCTCTTGGCCGATACAGTAAAGGACAAGCAGGCACTACAT
GTAAAGTGCGGGGTGACGCTGTCTCATTTGCTCAATCTCTTGTCGATTGGAGAGTTCATCAAGGCTGTGGAGAGC
TTGCTGGACAGACAAGAAATGGGTCTCCGACACAAGGTGCTGCGGGCACTAGAGGTTCGCGTAGCGACCGAGGAC
AAGACGGACACAAGAGCTCGGCAAGTGTTGCTCGGATTTCTGCCACAGCTGACGGCGGCGATTCGCGACTCGAGC
AGCATTTGGGACAAGCACACTGCGGTGACATGCGTGGACAAGATTGCGGAAAAGTACGGCAAAATGGATGTTGAG
GTGGTTGTGGCAGCGGCAGAAACGATTGCGGGAGAGTCTTGTCTGGGCCAAGAAGATGGACGGCTCCGTGTCATG
GCGCTTCTTTGTCTCACGTCGCTGGTGGACGCGCTACAAGATGGCATTGTGCCTGTGCTCCCGATTGCAATTCCA
AAGGCCATGGGATATCTTGAATCAAGCATCGAGGGCAACGAAGTTGACGAGGATCTTCATTCTGCCTGCTTTGGA
TTCCTGAGCTCCATGGCACAACATGTTGGCTACATGCTTTCCAGCTATAGCGACAGATTGCTCAAGGTGTGCGAC
AAGTCGGCTGAGGCAGGACTGAGCGACGACGCAAATAGTAGCCGGGTTGGGTGTCTGGGCATCATGGCCAAGCGG
CTGGATGCAAATGACTTGTTGACGAGCTTGAAGGGCAACTGGGAGAATAGCGTGAGGCTGGGACTAGGGGTAAGC
AGGGAAATCTTATGTGGAGCGTTTCTACAGTGTTGCTGACGACGTTGGCATAGGCTGTGTCTGAGAAGCTCGACA
TGGTGGGCATGGTGATTGATAAGCAGGCAAAGTCCAAGGTTGCAAAATTTGCGCCTTTGCTCTTGTCGATTCTCC
TGGAAGGGTTTGACATGCGACGACAGCTGCACAGCACAGGGCGCCATGATGAAAGGACAATGCGGCAACTGGACA
AGGTAGAGGCGAGCACGAGCGAAAAGGCGCTCAAGATGGTTTACAAGCTCAATGATGCAGCGTTCCGGCCGATTT
TTGTGGAAATGATGGAATGGACGGGGACGGGAGCAGCAGGACAGGAGAGAAGAAGTCGGATTGATAGGAAATGGC
CCATGTATGGCTTCTTTCTGACCTTTTTCCAACAGCTCAAGTCGATTGTGAGCAGCTACGCAAGCTACATTGTTG
ACGACGCGGTCAAGATCTTGGGCAGCGCGGACATGGAGGACGAGTTTGAAAAGGCGCTGTGGAGGCGGGTGGTGA
AGACGCTGGCGACGTGTTTTGAGCACGACCAAGACGAATTCTGGCAGGCGCCGGCGCATTTCGAGGCTGTGGCTC
CCAGCGTGGCAGACCAGCTGCTCCGGGCCGAGGCGGTGGATGTGACGGAGGAGGTGGTGCCGGCCGTGGTGGAGC
TGGCGGCAGCAGCCGACTCACAAAAGCACCAGCGCGATCTCAATGGGCGGCTCATGAGGCATGTGCAGTCGTCGC
GGCGAGAGGTTCGGGTGGCGGCAGTCAAGTGTCAGCAGGCATTGACGGAGCGGCTGGGGGAGGAGTGGCTGTCTA
TGCTGCATGAGATGCTGCCGCGCATCAGCGAGCTGCAAGAGGACCATGATGAAGAGGTGGAAAAGGAGACGCATC
GGTGGATTGTCAAGATTGAGGGGGTGCTGGGGGAGAGTCTGGATGCCATGTTGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail