Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4923
Gene name
LocationContig_43:2940..4720
Strand-
Gene length (bp)1780
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02110 HK Hydroxyethylthiazole kinase family 6.7E-79 236 483
PF02581 TMP-TENI Thiamine monophosphate synthase 5.2E-56 14 209
PF01256 Carb_kinase Carbohydrate kinase 2.3E-07 233 464

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40386|THI6_SCHPO Probable thiamine biosynthetic bifunctional enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi4 PE=2 SV=1 7 500 9.0E-112
sp|P41835|THI6_YEAST Thiamine biosynthetic bifunctional enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI6 PE=3 SV=1 7 498 6.0E-84
sp|Q0W1L9|THIM_METAR Hydroxyethylthiazole kinase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=thiM PE=3 SV=1 234 482 2.0E-58
sp|Q6AQZ6|THIM_DESPS Hydroxyethylthiazole kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=thiM PE=3 SV=2 235 482 1.0E-57
sp|B0K3V0|THIM_THEPX Hydroxyethylthiazole kinase OS=Thermoanaerobacter sp. (strain X514) GN=thiM PE=3 SV=1 230 490 2.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40386|THI6_SCHPO Probable thiamine biosynthetic bifunctional enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi4 PE=2 SV=1 7 500 9.0E-112
sp|P41835|THI6_YEAST Thiamine biosynthetic bifunctional enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI6 PE=3 SV=1 7 498 6.0E-84
sp|Q0W1L9|THIM_METAR Hydroxyethylthiazole kinase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=thiM PE=3 SV=1 234 482 2.0E-58
sp|Q6AQZ6|THIM_DESPS Hydroxyethylthiazole kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=thiM PE=3 SV=2 235 482 1.0E-57
sp|B0K3V0|THIM_THEPX Hydroxyethylthiazole kinase OS=Thermoanaerobacter sp. (strain X514) GN=thiM PE=3 SV=1 230 490 2.0E-57
sp|B0KBA7|THIM_THEP3 Hydroxyethylthiazole kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=thiM PE=3 SV=1 230 490 2.0E-56
sp|Q8R807|THIM_CALS4 Hydroxyethylthiazole kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thiM PE=3 SV=1 233 482 1.0E-55
sp|O58877|THIM_PYRHO Hydroxyethylthiazole kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=thiM PE=1 SV=1 235 484 4.0E-55
sp|A6VPG7|THIM_ACTSZ Hydroxyethylthiazole kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=thiM PE=3 SV=1 233 484 7.0E-55
sp|C0QWJ2|THIM_BRAHW Hydroxyethylthiazole kinase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=thiM PE=3 SV=1 235 482 4.0E-52
sp|B7JN71|THIM_BACC0 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain AH820) GN=thiM PE=3 SV=1 231 479 4.0E-52
sp|Q81Z96|THIM_BACAN Hydroxyethylthiazole kinase OS=Bacillus anthracis GN=thiM PE=3 SV=1 231 479 4.0E-52
sp|C3L626|THIM_BACAC Hydroxyethylthiazole kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=thiM PE=3 SV=1 231 479 4.0E-52
sp|C3PBW0|THIM_BACAA Hydroxyethylthiazole kinase OS=Bacillus anthracis (strain A0248) GN=thiM PE=3 SV=1 231 479 4.0E-52
sp|C1EVE5|THIM_BACC3 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain 03BB102) GN=thiM PE=3 SV=1 231 479 5.0E-52
sp|A0R980|THIM_BACAH Hydroxyethylthiazole kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=thiM PE=3 SV=2 231 479 5.0E-52
sp|Q0I129|THIM_HAES1 Hydroxyethylthiazole kinase OS=Haemophilus somnus (strain 129Pt) GN=thiM PE=3 SV=1 233 479 6.0E-52
sp|A8FIR7|THIM_BACP2 Hydroxyethylthiazole kinase OS=Bacillus pumilus (strain SAFR-032) GN=thiM PE=3 SV=1 229 479 8.0E-52
sp|A9VRN3|THIM_BACWK Hydroxyethylthiazole kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=thiM PE=3 SV=1 231 479 5.0E-51
sp|Q9UZQ4|THIM_PYRAB Hydroxyethylthiazole kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=thiM PE=3 SV=2 229 482 5.0E-51
sp|A8M9N5|THIM_CALMQ Hydroxyethylthiazole kinase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=thiM PE=3 SV=1 227 502 7.0E-51
sp|A7GKR3|THIM_BACCN Hydroxyethylthiazole kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=thiM PE=3 SV=1 231 482 1.0E-50
sp|A5UA73|THIM_HAEIE Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain PittEE) GN=thiM PE=3 SV=1 237 462 1.0E-50
sp|Q57233|THIM_HAEIN Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiM PE=3 SV=1 235 479 1.0E-50
sp|Q6HP18|THIM_BACHK Hydroxyethylthiazole kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=thiM PE=3 SV=1 231 479 1.0E-50
sp|B8FJW2|THIM_DESAA Hydroxyethylthiazole kinase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=thiM PE=3 SV=1 233 483 1.0E-50
sp|Q63GK4|THIM_BACCZ Hydroxyethylthiazole kinase OS=Bacillus cereus (strain ZK / E33L) GN=thiM PE=3 SV=1 231 479 2.0E-50
sp|Q4QNC8|THIM_HAEI8 Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain 86-028NP) GN=thiM PE=3 SV=1 235 479 2.0E-50
sp|Q73E73|THIM_BACC1 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=thiM PE=3 SV=1 231 479 4.0E-50
sp|A5UGS9|THIM_HAEIG Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain PittGG) GN=thiM PE=3 SV=1 235 479 6.0E-50
sp|B7GKQ7|THIM_ANOFW Hydroxyethylthiazole kinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=thiM PE=3 SV=1 237 490 6.0E-50
sp|B9J2L4|THIM_BACCQ Hydroxyethylthiazole kinase OS=Bacillus cereus (strain Q1) GN=thiM PE=3 SV=1 231 479 8.0E-50
sp|B7HT69|THIM_BACC7 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain AH187) GN=thiM PE=3 SV=1 231 479 8.0E-50
sp|A8ZV98|THIM_DESOH Hydroxyethylthiazole kinase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=thiM PE=3 SV=1 236 482 9.0E-50
sp|Q8PS50|THIM_METMA Hydroxyethylthiazole kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=thiM PE=3 SV=1 231 482 1.0E-49
sp|B8DET2|THIM_LISMH Hydroxyethylthiazole kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=thiM PE=3 SV=1 235 479 2.0E-49
sp|Q65DJ9|THIM_BACLD Hydroxyethylthiazole kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=thiM PE=3 SV=1 233 479 2.0E-49
sp|Q2FNE1|THIM_METHJ Hydroxyethylthiazole kinase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=thiM PE=3 SV=1 227 484 3.0E-49
sp|B7H7H4|THIM_BACC4 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain B4264) GN=thiM PE=3 SV=1 231 479 4.0E-49
sp|Q92EW7|THIM_LISIN Hydroxyethylthiazole kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=thiM PE=3 SV=1 234 479 4.0E-49
sp|Q81IG9|THIM_BACCR Hydroxyethylthiazole kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=thiM PE=3 SV=1 231 479 5.0E-49
sp|B7IVS8|THIM_BACC2 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain G9842) GN=thiM PE=3 SV=1 231 479 5.0E-49
sp|Q8YA46|THIM_LISMO Hydroxyethylthiazole kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=thiM PE=3 SV=1 235 479 6.0E-49
sp|P57931|THIM_PASMU Hydroxyethylthiazole kinase OS=Pasteurella multocida (strain Pm70) GN=thiM PE=3 SV=1 230 486 7.0E-49
sp|B5Y6I0|THIM_COPPD Hydroxyethylthiazole kinase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=thiM PE=3 SV=1 233 491 9.0E-49
sp|Q8ESZ2|THIM1_OCEIH Hydroxyethylthiazole kinase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thiM1 PE=3 SV=1 234 488 1.0E-48
sp|Q2YUL1|THIM_STAAB Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thiM PE=3 SV=1 235 489 1.0E-48
sp|C1KZ32|THIM_LISMC Hydroxyethylthiazole kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=thiM PE=3 SV=1 235 479 1.0E-48
sp|Q6GEY3|THIM_STAAR Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain MRSA252) GN=thiM PE=3 SV=1 242 489 2.0E-48
sp|B8G7I8|THIM_CHLAD Hydroxyethylthiazole kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=thiM PE=3 SV=1 237 482 2.0E-48
sp|C5D2N0|THIM_GEOSW Hydroxyethylthiazole kinase OS=Geobacillus sp. (strain WCH70) GN=thiM PE=3 SV=1 235 482 2.0E-48
sp|Q723Z1|THIM_LISMF Hydroxyethylthiazole kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=thiM PE=3 SV=2 235 479 2.0E-48
sp|Q5WDW4|THIM_BACSK Hydroxyethylthiazole kinase OS=Bacillus clausii (strain KSM-K16) GN=thiM PE=3 SV=1 238 479 3.0E-48
sp|B2TQ14|THIM_CLOBB Hydroxyethylthiazole kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=thiM PE=3 SV=1 233 479 4.0E-48
sp|Q2RGX6|THIM_MOOTA Hydroxyethylthiazole kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=thiM PE=3 SV=1 236 482 4.0E-48
sp|P66923|THIM_STAAN Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain N315) GN=thiM PE=1 SV=1 235 489 4.0E-48
sp|P66922|THIM_STAAM Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thiM PE=3 SV=1 235 489 4.0E-48
sp|A5IUN8|THIM_STAA9 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain JH9) GN=thiM PE=3 SV=1 235 489 4.0E-48
sp|A6U3H8|THIM_STAA2 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain JH1) GN=thiM PE=3 SV=1 235 489 4.0E-48
sp|A7X4S9|THIM_STAA1 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thiM PE=3 SV=1 235 489 4.0E-48
sp|A6QIT6|THIM_STAAE Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain Newman) GN=thiM PE=3 SV=1 235 489 7.0E-48
sp|Q5HEA7|THIM_STAAC Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain COL) GN=thiM PE=3 SV=1 235 489 7.0E-48
sp|Q2FWG2|THIM_STAA8 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=thiM PE=3 SV=1 235 489 7.0E-48
sp|Q2FF34|THIM_STAA3 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain USA300) GN=thiM PE=3 SV=1 235 489 7.0E-48
sp|A0LP26|THIM_SYNFM Hydroxyethylthiazole kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=thiM PE=3 SV=1 233 479 9.0E-48
sp|A8MK93|THIM_ALKOO Hydroxyethylthiazole kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=thiM PE=3 SV=1 227 477 2.0E-47
sp|Q8NVH4|THIM_STAAW Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain MW2) GN=thiM PE=3 SV=1 235 489 3.0E-47
sp|Q6G7L8|THIM_STAAS Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain MSSA476) GN=thiM PE=3 SV=1 235 489 3.0E-47
sp|Q466J4|THIM_METBF Hydroxyethylthiazole kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=thiM PE=3 SV=1 235 482 4.0E-47
sp|B8I3J5|THIM_CLOCE Hydroxyethylthiazole kinase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=thiM PE=3 SV=1 231 492 1.0E-46
sp|A0AFC3|THIM_LISW6 Hydroxyethylthiazole kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=thiM PE=3 SV=1 235 479 1.0E-46
sp|Q9RGS6|THIM_STACT Hydroxyethylthiazole kinase OS=Staphylococcus carnosus (strain TM300) GN=thiM PE=3 SV=1 231 482 2.0E-46
sp|A2SU11|THIM_METLZ Hydroxyethylthiazole kinase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=thiM PE=3 SV=1 233 499 4.0E-46
sp|A0Q2A0|THIE_CLONN Thiamine-phosphate synthase OS=Clostridium novyi (strain NT) GN=thiE PE=3 SV=1 10 222 4.0E-46
sp|Q8ESJ1|THIM2_OCEIH Hydroxyethylthiazole kinase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thiM2 PE=3 SV=1 231 491 6.0E-46
sp|B0SMR8|THIM_LEPBP Hydroxyethylthiazole kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=thiM PE=3 SV=1 243 486 2.0E-45
sp|B0SE82|THIM_LEPBA Hydroxyethylthiazole kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=thiM PE=3 SV=1 243 486 2.0E-45
sp|Q49Z40|THIM_STAS1 Hydroxyethylthiazole kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thiM PE=3 SV=1 235 482 2.0E-45
sp|Q6LPQ4|THIM_PHOPR Hydroxyethylthiazole kinase OS=Photobacterium profundum GN=thiM PE=3 SV=1 235 485 4.0E-45
sp|Q5HMC9|THIM_STAEQ Hydroxyethylthiazole kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=thiM PE=3 SV=1 235 489 5.0E-45
sp|Q8TMD5|THIM_METAC Hydroxyethylthiazole kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thiM PE=3 SV=1 231 482 6.0E-45
sp|B2UY66|THIM_CLOBA Hydroxyethylthiazole kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=thiM PE=3 SV=1 233 479 6.0E-45
sp|A4J233|THIM_DESRM Hydroxyethylthiazole kinase OS=Desulfotomaculum reducens (strain MI-1) GN=thiM PE=3 SV=1 236 480 6.0E-45
sp|A6M1W7|THIM_CLOB8 Hydroxyethylthiazole kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thiM PE=3 SV=1 234 482 1.0E-44
sp|Q4L7X4|THIM_STAHJ Hydroxyethylthiazole kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=thiM PE=3 SV=1 235 489 1.0E-44
sp|A7NRF8|THIM_ROSCS Hydroxyethylthiazole kinase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=thiM PE=3 SV=1 233 482 2.0E-44
sp|Q893R0|THIE_CLOTE Thiamine-phosphate synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=thiE PE=3 SV=2 8 222 2.0E-44
sp|Q2NGH3|THIM1_METST Hydroxyethylthiazole kinase 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=thiM1 PE=3 SV=1 233 486 3.0E-44
sp|Q8CRN9|THIM_STAES Hydroxyethylthiazole kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=thiM PE=3 SV=1 235 489 3.0E-44
sp|O28204|THIM_ARCFU Hydroxyethylthiazole kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thiM PE=3 SV=1 227 482 4.0E-44
sp|Q6LY53|THIM_METMP Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=thiM PE=3 SV=2 230 482 4.0E-44
sp|C3L061|THIE_CLOB6 Thiamine-phosphate synthase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thiE PE=3 SV=1 9 223 4.0E-44
sp|C0ZGJ5|THIM_BREBN Hydroxyethylthiazole kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=thiM PE=3 SV=1 226 482 5.0E-44
sp|A7GAL0|THIE_CLOBL Thiamine-phosphate synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thiE PE=3 SV=1 9 223 5.0E-44
sp|A5HYZ3|THIE_CLOBH Thiamine-phosphate synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thiE PE=3 SV=1 9 223 6.0E-44
sp|A7FPT0|THIE_CLOB1 Thiamine-phosphate synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thiE PE=3 SV=1 9 223 6.0E-44
sp|B1KV12|THIE_CLOBM Thiamine-phosphate synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thiE PE=3 SV=1 9 223 6.0E-44
sp|Q8F0X6|THIM_LEPIN Hydroxyethylthiazole kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=thiM PE=3 SV=1 224 479 7.0E-44
sp|B1IEG6|THIE_CLOBK Thiamine-phosphate synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=thiE PE=3 SV=1 9 223 7.0E-44
sp|A7IA08|THIM_METB6 Hydroxyethylthiazole kinase OS=Methanoregula boonei (strain 6A8) GN=thiM PE=3 SV=1 234 482 7.0E-44
sp|Q8U191|THIM_PYRFU Hydroxyethylthiazole kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=thiM PE=3 SV=1 237 480 8.0E-44
sp|C1FSC1|THIE_CLOBJ Thiamine-phosphate synthase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thiE PE=3 SV=1 9 223 9.0E-44
sp|Q72U64|THIM_LEPIC Hydroxyethylthiazole kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=thiM PE=3 SV=1 224 479 1.0E-43
sp|A5UUL2|THIM_ROSS1 Hydroxyethylthiazole kinase OS=Roseiflexus sp. (strain RS-1) GN=thiM PE=3 SV=1 234 482 2.0E-43
sp|B3Q1Q5|THIM_RHIE6 Hydroxyethylthiazole kinase OS=Rhizobium etli (strain CIAT 652) GN=thiM PE=3 SV=1 234 479 2.0E-43
sp|C4L8H9|THIM_TOLAT Hydroxyethylthiazole kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=thiM PE=3 SV=1 235 486 2.0E-43
sp|A6UPE5|THIM_METVS Hydroxyethylthiazole kinase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=thiM PE=3 SV=1 243 504 3.0E-43
sp|B1KV13|THIM2_CLOBM Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thiM2 PE=3 SV=1 233 493 3.0E-43
sp|B1I1S3|THIM_DESAP Hydroxyethylthiazole kinase OS=Desulforudis audaxviator (strain MP104C) GN=thiM PE=3 SV=1 227 482 4.0E-43
sp|A4IN26|THIM_GEOTN Hydroxyethylthiazole kinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=thiM PE=3 SV=1 233 482 5.0E-43
sp|B3QT42|THIM_CHLT3 Hydroxyethylthiazole kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=thiM PE=3 SV=1 243 485 6.0E-43
sp|C4KZE2|THIM_EXISA Hydroxyethylthiazole kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=thiM PE=3 SV=1 233 486 7.0E-43
sp|B2UP55|THIM_AKKM8 Hydroxyethylthiazole kinase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=thiM PE=3 SV=1 237 480 7.0E-43
sp|A4FX33|THIM_METM5 Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=thiM PE=3 SV=1 237 482 7.0E-43
sp|A0Q299|THIM_CLONN Hydroxyethylthiazole kinase OS=Clostridium novyi (strain NT) GN=thiM PE=3 SV=1 236 494 8.0E-43
sp|Q893Q9|THIM_CLOTE Hydroxyethylthiazole kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=thiM PE=3 SV=1 237 486 9.0E-43
sp|Q2LWX9|THIM_SYNAS Hydroxyethylthiazole kinase OS=Syntrophus aciditrophicus (strain SB) GN=thiM PE=3 SV=1 235 488 9.0E-43
sp|Q97LQ9|THIE_CLOAB Thiamine-phosphate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thiE PE=3 SV=1 8 229 2.0E-42
sp|A7ZA59|THIM_BACMF Hydroxyethylthiazole kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=thiM PE=3 SV=1 235 484 2.0E-42
sp|A5HYZ4|THIM1_CLOBH Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thiM1 PE=3 SV=1 233 493 2.0E-42
sp|A7FPT1|THIM1_CLOB1 Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thiM1 PE=3 SV=1 233 493 2.0E-42
sp|Q87JW7|THIM_VIBPA Hydroxyethylthiazole kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiM PE=3 SV=1 238 486 3.0E-42
sp|Q2K0X8|THIM_RHIEC Hydroxyethylthiazole kinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=thiM PE=3 SV=1 234 479 3.0E-42
sp|C1FSC2|THIM1_CLOBJ Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thiM1 PE=3 SV=1 233 493 3.0E-42
sp|Q21VL4|THIM_RHOFT Hydroxyethylthiazole kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=thiM PE=3 SV=1 238 469 4.0E-42
sp|C3L062|THIM1_CLOB6 Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thiM1 PE=3 SV=1 233 493 4.0E-42
sp|A6VG82|THIM_METM7 Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=thiM PE=3 SV=1 237 482 4.0E-42
sp|A7GAL1|THIM1_CLOBL Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thiM1 PE=3 SV=1 233 493 6.0E-42
sp|B1IEG7|THIM1_CLOBK Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Okra / Type B1) GN=thiM1 PE=3 SV=1 233 493 6.0E-42
sp|O25516|THIM_HELPY Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thiM PE=3 SV=2 234 479 2.0E-41
sp|B8GJF9|THIM_METPE Hydroxyethylthiazole kinase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=thiM PE=3 SV=1 235 479 2.0E-41
sp|A5ULP4|THIE_METS3 Thiamine-phosphate synthase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=thiE PE=3 SV=1 9 223 2.0E-41
sp|A9AAH0|THIM_METM6 Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=thiM PE=3 SV=1 237 482 3.0E-41
sp|B6ERB4|THIM_ALISL Hydroxyethylthiazole kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=thiM PE=3 SV=1 238 486 4.0E-41
sp|Q9ZKZ9|THIM_HELPJ Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thiM PE=3 SV=1 234 479 4.0E-41
sp|B5Z7K9|THIM_HELPG Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain G27) GN=thiM PE=3 SV=1 234 479 4.0E-41
sp|B1Y3E4|THIM_LEPCP Hydroxyethylthiazole kinase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=thiM PE=3 SV=2 235 469 5.0E-41
sp|Q24XQ0|THIE_DESHY Thiamine-phosphate synthase OS=Desulfitobacterium hafniense (strain Y51) GN=thiE PE=3 SV=1 10 223 5.0E-41
sp|Q5KZU2|THIM_GEOKA Hydroxyethylthiazole kinase OS=Geobacillus kaustophilus (strain HTA426) GN=thiM PE=3 SV=1 233 479 6.0E-41
sp|A7NRF7|THIE_ROSCS Thiamine-phosphate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=thiE PE=3 SV=1 14 222 6.0E-41
sp|Q0TFY8|THIM_ECOL5 Hydroxyethylthiazole kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thiM PE=3 SV=1 238 487 6.0E-41
sp|B8FUD4|THIE_DESHD Thiamine-phosphate synthase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=thiE PE=3 SV=1 10 223 8.0E-41
sp|A7N7S2|THIM_VIBCB Hydroxyethylthiazole kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=thiM PE=3 SV=1 238 486 9.0E-41
sp|Q3IP35|THIM_NATPD Hydroxyethylthiazole kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=thiM PE=3 SV=1 237 488 1.0E-40
sp|A5WDP1|THIM_PSYWF Hydroxyethylthiazole kinase OS=Psychrobacter sp. (strain PRwf-1) GN=thiM PE=3 SV=1 229 483 1.0E-40
sp|A1JQJ2|THIM_YERE8 Hydroxyethylthiazole kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=thiM PE=3 SV=1 235 486 1.0E-40
sp|Q1CT25|THIM_HELPH Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain HPAG1) GN=thiM PE=3 SV=1 234 479 1.0E-40
sp|Q0BVF4|THIM_GRABC Hydroxyethylthiazole kinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=thiM PE=3 SV=2 238 494 2.0E-40
sp|B4TNK3|THIM_SALSV Hydroxyethylthiazole kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=thiM PE=3 SV=1 228 489 2.0E-40
sp|Q312G9|THIM_DESAG Hydroxyethylthiazole kinase OS=Desulfovibrio alaskensis (strain G20) GN=thiM PE=3 SV=1 229 484 2.0E-40
sp|B8I3J4|THIE_CLOCE Thiamine-phosphate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=thiE PE=3 SV=1 7 224 3.0E-40
sp|B8FUD3|THIM_DESHD Hydroxyethylthiazole kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=thiM PE=3 SV=1 227 488 3.0E-40
sp|A9MKV9|THIM_SALAR Hydroxyethylthiazole kinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=thiM PE=3 SV=2 228 482 3.0E-40
sp|Q24XQ1|THIM_DESHY Hydroxyethylthiazole kinase OS=Desulfitobacterium hafniense (strain Y51) GN=thiM PE=3 SV=1 227 489 4.0E-40
sp|Q824E8|THIM_CHLCV Hydroxyethylthiazole kinase OS=Chlamydophila caviae (strain GPIC) GN=thiM PE=3 SV=1 231 488 5.0E-40
sp|Q63GK3|THIE_BACCZ Thiamine-phosphate synthase OS=Bacillus cereus (strain ZK / E33L) GN=thiE PE=3 SV=1 13 230 7.0E-40
sp|B7MWQ4|THIM_ECO81 Hydroxyethylthiazole kinase OS=Escherichia coli O81 (strain ED1a) GN=thiM PE=3 SV=1 238 487 8.0E-40
sp|Q81IG8|THIE_BACCR Thiamine-phosphate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=thiE PE=3 SV=2 13 230 1.0E-39
sp|Q6D299|THIM_PECAS Hydroxyethylthiazole kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiM PE=3 SV=1 235 483 1.0E-39
sp|Q3AE32|THIM_CARHZ Hydroxyethylthiazole kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=thiM PE=3 SV=1 231 484 1.0E-39
sp|A6TMN6|THIM_ALKMQ Hydroxyethylthiazole kinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=thiM PE=3 SV=1 233 486 1.0E-39
sp|B6A3G5|THIM_RHILW Hydroxyethylthiazole kinase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=thiM PE=3 SV=1 234 486 1.0E-39
sp|B8J4C1|THIM_DESDA Hydroxyethylthiazole kinase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=thiM PE=3 SV=1 234 461 1.0E-39
sp|B7H7H5|THIE_BACC4 Thiamine-phosphate synthase OS=Bacillus cereus (strain B4264) GN=thiE PE=3 SV=1 13 230 2.0E-39
sp|B4SXX8|THIM_SALNS Hydroxyethylthiazole kinase OS=Salmonella newport (strain SL254) GN=thiM PE=3 SV=1 228 482 2.0E-39
sp|Q1R9W8|THIM_ECOUT Hydroxyethylthiazole kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=thiM PE=3 SV=1 238 487 2.0E-39
sp|A1ACX0|THIM_ECOK1 Hydroxyethylthiazole kinase OS=Escherichia coli O1:K1 / APEC GN=thiM PE=3 SV=1 238 487 2.0E-39
sp|B7MEF9|THIM_ECO45 Hydroxyethylthiazole kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=thiM PE=3 SV=1 238 487 2.0E-39
sp|Q32EA0|THIM_SHIDS Hydroxyethylthiazole kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thiM PE=3 SV=1 238 487 2.0E-39
sp|P55883|THIM_SALTY Hydroxyethylthiazole kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiM PE=3 SV=1 228 482 2.0E-39
sp|B5RBY7|THIM_SALG2 Hydroxyethylthiazole kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=thiM PE=3 SV=1 228 482 2.0E-39
sp|B5R0D9|THIM_SALEP Hydroxyethylthiazole kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=thiM PE=3 SV=1 228 482 2.0E-39
sp|B5FMW2|THIM_SALDC Hydroxyethylthiazole kinase OS=Salmonella dublin (strain CT_02021853) GN=thiM PE=3 SV=1 228 482 2.0E-39
sp|A6TMN5|THIE_ALKMQ Thiamine-phosphate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=thiE PE=3 SV=1 1 222 2.0E-39
sp|Q8FFY0|THIM_ECOL6 Hydroxyethylthiazole kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thiM PE=3 SV=1 238 487 2.0E-39
sp|B5EXY6|THIM_SALA4 Hydroxyethylthiazole kinase OS=Salmonella agona (strain SL483) GN=thiM PE=3 SV=1 228 482 2.0E-39
sp|B8DJ66|THIM_DESVM Hydroxyethylthiazole kinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=thiM PE=3 SV=1 233 485 2.0E-39
sp|B7JN72|THIE_BACC0 Thiamine-phosphate synthase OS=Bacillus cereus (strain AH820) GN=thiE PE=3 SV=1 13 230 2.0E-39
sp|A9WDL8|THIE_CHLAA Thiamine-phosphate synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=thiE PE=3 SV=1 10 191 2.0E-39
sp|B9J2L5|THIE_BACCQ Thiamine-phosphate synthase OS=Bacillus cereus (strain Q1) GN=thiE PE=3 SV=1 13 230 3.0E-39
sp|B7HT70|THIE_BACC7 Thiamine-phosphate synthase OS=Bacillus cereus (strain AH187) GN=thiE PE=3 SV=1 13 230 3.0E-39
sp|B4T9W1|THIM_SALHS Hydroxyethylthiazole kinase OS=Salmonella heidelberg (strain SL476) GN=thiM PE=3 SV=1 228 482 3.0E-39
sp|B1YJJ2|THIM_EXIS2 Hydroxyethylthiazole kinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=thiM PE=3 SV=1 234 477 3.0E-39
sp|B9LIA5|THIM_CHLSY Hydroxyethylthiazole kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=thiM PE=3 SV=1 227 482 3.0E-39
sp|A9WDL9|THIM_CHLAA Hydroxyethylthiazole kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=thiM PE=3 SV=1 227 482 3.0E-39
sp|B8F7P4|THIM_HAEPS Hydroxyethylthiazole kinase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=thiM PE=3 SV=1 232 489 3.0E-39
sp|B5YV51|THIM_ECO5E Hydroxyethylthiazole kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=thiM PE=3 SV=1 238 487 3.0E-39
sp|Q8X7G3|THIM_ECO57 Hydroxyethylthiazole kinase OS=Escherichia coli O157:H7 GN=thiM PE=3 SV=1 238 487 3.0E-39
sp|Q8Z5C8|THIM_SALTI Hydroxyethylthiazole kinase OS=Salmonella typhi GN=thiM PE=3 SV=1 228 482 3.0E-39
sp|B7NPM9|THIM_ECO7I Hydroxyethylthiazole kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=thiM PE=3 SV=1 242 487 3.0E-39
sp|Q38ZL9|THIM_LACSS Hydroxyethylthiazole kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=thiM PE=3 SV=1 234 485 4.0E-39
sp|Q57MJ3|THIM_SALCH Hydroxyethylthiazole kinase OS=Salmonella choleraesuis (strain SC-B67) GN=thiM PE=3 SV=1 228 489 4.0E-39
sp|C1EVE6|THIE_BACC3 Thiamine-phosphate synthase OS=Bacillus cereus (strain 03BB102) GN=thiE PE=3 SV=1 13 230 4.0E-39
sp|A1SX95|THIM_PSYIN Hydroxyethylthiazole kinase OS=Psychromonas ingrahamii (strain 37) GN=thiM PE=3 SV=1 235 486 4.0E-39
sp|A0R981|THIE_BACAH Thiamine-phosphate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=thiE PE=3 SV=1 13 230 5.0E-39
sp|Q6HP17|THIE_BACHK Thiamine-phosphate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=thiE PE=3 SV=1 13 230 5.0E-39
sp|A8AEC1|THIM_CITK8 Hydroxyethylthiazole kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=thiM PE=3 SV=1 228 482 6.0E-39
sp|Q5E0Q5|THIM_VIBF1 Hydroxyethylthiazole kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thiM PE=3 SV=1 238 486 7.0E-39
sp|C6DBE0|THIM_PECCP Hydroxyethylthiazole kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=thiM PE=3 SV=1 235 483 7.0E-39
sp|B5ET96|THIM_VIBFM Hydroxyethylthiazole kinase OS=Vibrio fischeri (strain MJ11) GN=thiM PE=3 SV=1 238 486 8.0E-39
sp|B7NCD4|THIM_ECOLU Hydroxyethylthiazole kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thiM PE=3 SV=1 238 482 9.0E-39
sp|B2USY3|THIM_HELPS Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain Shi470) GN=thiM PE=3 SV=1 234 479 9.0E-39
sp|P39593|THIM_BACSU Hydroxyethylthiazole kinase OS=Bacillus subtilis (strain 168) GN=thiM PE=1 SV=1 243 501 9.0E-39
sp|A4WCE6|THIM_ENT38 Hydroxyethylthiazole kinase OS=Enterobacter sp. (strain 638) GN=thiM PE=3 SV=1 242 482 9.0E-39
sp|A9N7J2|THIM_SALPB Hydroxyethylthiazole kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=thiM PE=3 SV=1 228 482 1.0E-38
sp|B6HYU5|THIM_ECOSE Hydroxyethylthiazole kinase OS=Escherichia coli (strain SE11) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|B7M485|THIM_ECO8A Hydroxyethylthiazole kinase OS=Escherichia coli O8 (strain IAI1) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|B7L9X5|THIM_ECO55 Hydroxyethylthiazole kinase OS=Escherichia coli (strain 55989 / EAEC) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|P76423|THIM_ECOLI Hydroxyethylthiazole kinase OS=Escherichia coli (strain K12) GN=thiM PE=1 SV=1 238 487 1.0E-38
sp|B1IYX7|THIM_ECOLC Hydroxyethylthiazole kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|A8A1W9|THIM_ECOHS Hydroxyethylthiazole kinase OS=Escherichia coli O9:H4 (strain HS) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|B1X7J5|THIM_ECODH Hydroxyethylthiazole kinase OS=Escherichia coli (strain K12 / DH10B) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|C4ZSI8|THIM_ECOBW Hydroxyethylthiazole kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|B1LN84|THIM_ECOSM Hydroxyethylthiazole kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=thiM PE=3 SV=1 238 487 1.0E-38
sp|Q8R806|THIE_CALS4 Thiamine-phosphate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thiE PE=3 SV=2 8 233 1.0E-38
sp|Q04YC8|THIM_LEPBL Hydroxyethylthiazole kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=thiM PE=3 SV=1 237 482 1.0E-38
sp|Q04V49|THIM_LEPBJ Hydroxyethylthiazole kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=thiM PE=3 SV=1 237 482 1.0E-38
sp|Q323B8|THIM_SHIBS Hydroxyethylthiazole kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=thiM PE=3 SV=1 238 487 2.0E-38
sp|B2TY84|THIM_SHIB3 Hydroxyethylthiazole kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=thiM PE=3 SV=1 238 487 2.0E-38
sp|Q186F4|THIM_PEPD6 Hydroxyethylthiazole kinase OS=Peptoclostridium difficile (strain 630) GN=thiM PE=3 SV=1 231 482 2.0E-38
sp|B5BF36|THIM_SALPK Hydroxyethylthiazole kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=thiM PE=3 SV=1 228 482 2.0E-38
sp|Q5PMV9|THIM_SALPA Hydroxyethylthiazole kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thiM PE=3 SV=1 228 482 2.0E-38
sp|C1DCM4|THIM_LARHH Hydroxyethylthiazole kinase OS=Laribacter hongkongensis (strain HLHK9) GN=thiM PE=3 SV=1 231 485 2.0E-38
sp|A7ZNS3|THIM_ECO24 Hydroxyethylthiazole kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=thiM PE=3 SV=1 238 487 3.0E-38
sp|B9JK65|THIM_AGRRK Hydroxyethylthiazole kinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=thiM PE=3 SV=1 243 479 3.0E-38
sp|A9VRN4|THIE_BACWK Thiamine-phosphate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=thiE PE=3 SV=1 14 230 3.0E-38
sp|B7VS66|THIM_VIBTL Hydroxyethylthiazole kinase OS=Vibrio tasmaniensis (strain LGP32) GN=thiM PE=3 SV=2 222 486 3.0E-38
sp|Q0AZ86|THIE_SYNWW Thiamine-phosphate synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thiE PE=3 SV=1 11 222 3.0E-38
sp|C0Q0Y8|THIM_SALPC Hydroxyethylthiazole kinase OS=Salmonella paratyphi C (strain RKS4594) GN=thiM PE=3 SV=1 228 489 6.0E-38
sp|A8MK92|THIE_ALKOO Thiamine-phosphate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=thiE PE=3 SV=1 10 226 8.0E-38
sp|A7MHJ8|THIM_CROS8 Hydroxyethylthiazole kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=thiM PE=3 SV=1 234 480 8.0E-38
sp|A6M1W6|THIE_CLOB8 Thiamine-phosphate synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thiE PE=3 SV=1 7 228 1.0E-37
sp|P61410|THIE_BACC1 Thiamine-phosphate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=thiE PE=3 SV=1 13 228 1.0E-37
sp|Q81Z95|THIE_BACAN Thiamine-phosphate synthase OS=Bacillus anthracis GN=thiE PE=3 SV=1 13 230 1.0E-37
sp|C3L627|THIE_BACAC Thiamine-phosphate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=thiE PE=3 SV=1 13 230 1.0E-37
sp|C3PBW1|THIE_BACAA Thiamine-phosphate synthase OS=Bacillus anthracis (strain A0248) GN=thiE PE=3 SV=1 13 230 1.0E-37
sp|A5ULP3|THIM_METS3 Hydroxyethylthiazole kinase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=thiM PE=3 SV=1 231 482 1.0E-37
sp|Q9KCY8|THIE_BACHD Thiamine-phosphate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thiE PE=3 SV=1 28 229 1.0E-37
sp|B7UFC1|THIM_ECO27 Hydroxyethylthiazole kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=thiM PE=3 SV=1 238 487 1.0E-37
sp|Q83KH2|THIM_SHIFL Hydroxyethylthiazole kinase OS=Shigella flexneri GN=thiM PE=3 SV=1 238 487 2.0E-37
sp|Q0T335|THIM_SHIF8 Hydroxyethylthiazole kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=thiM PE=3 SV=1 238 487 2.0E-37
sp|Q6A9C5|THIM_PROAC Hydroxyethylthiazole kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=thiM PE=3 SV=2 225 482 2.0E-37
sp|B2A1A8|THIM_NATTJ Hydroxyethylthiazole kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=thiM PE=3 SV=1 237 461 3.0E-37
sp|A5UUL3|THIE_ROSS1 Thiamine-phosphate synthase OS=Roseiflexus sp. (strain RS-1) GN=thiE PE=3 SV=1 14 233 3.0E-37
sp|B2TQ13|THIE_CLOBB Thiamine-phosphate synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=thiE PE=3 SV=1 7 222 3.0E-37
sp|B2UY65|THIE_CLOBA Thiamine-phosphate synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=thiE PE=3 SV=1 7 228 4.0E-37
sp|B9E8D6|THIM_MACCJ Hydroxyethylthiazole kinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=thiM PE=3 SV=1 235 484 5.0E-37
sp|Q3Z0A6|THIM_SHISS Hydroxyethylthiazole kinase OS=Shigella sonnei (strain Ss046) GN=thiM PE=3 SV=1 238 487 5.0E-37
sp|A8IGE6|THIE_AZOC5 Thiamine-phosphate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=thiE PE=3 SV=2 10 229 5.0E-37
sp|Q2NGG1|THIM2_METST Hydroxyethylthiazole kinase 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=thiM2 PE=3 SV=1 235 486 6.0E-37
sp|A9AZE0|THIM_HERA2 Hydroxyethylthiazole kinase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=thiM PE=3 SV=1 238 490 7.0E-37
sp|Q65DK0|THIE_BACLD Thiamine-phosphate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=thiE PE=3 SV=1 13 226 1.0E-36
sp|Q9K7L2|THIM_BACHD Hydroxyethylthiazole kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thiM PE=3 SV=1 235 482 1.0E-36
sp|Q253G3|THIM_CHLFF Hydroxyethylthiazole kinase OS=Chlamydophila felis (strain Fe/C-56) GN=thiM PE=3 SV=1 231 484 3.0E-36
sp|A5N1D3|THIM_CLOK5 Hydroxyethylthiazole kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=thiM PE=3 SV=1 233 493 3.0E-36
sp|B9E564|THIM_CLOK1 Hydroxyethylthiazole kinase OS=Clostridium kluyveri (strain NBRC 12016) GN=thiM PE=3 SV=1 233 493 3.0E-36
sp|Q1M5U3|THIM_RHIL3 Hydroxyethylthiazole kinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=thiM PE=3 SV=1 234 479 7.0E-36
sp|Q03GM6|THIM_PEDPA Hydroxyethylthiazole kinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=thiM PE=3 SV=1 235 482 7.0E-36
sp|A7GKR4|THIE_BACCN Thiamine-phosphate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=thiE PE=3 SV=1 13 228 8.0E-36
sp|Q97EL4|THIM_CLOAB Hydroxyethylthiazole kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thiM PE=3 SV=1 230 482 8.0E-36
sp|B7LV66|THIM_ESCF3 Hydroxyethylthiazole kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thiM PE=3 SV=1 235 487 2.0E-35
sp|B1HX32|THIM_LYSSC Hydroxyethylthiazole kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=thiM PE=3 SV=1 234 487 2.0E-35
sp|Q5WH87|THIE_BACSK Thiamine-phosphate synthase OS=Bacillus clausii (strain KSM-K16) GN=thiE PE=3 SV=1 28 224 3.0E-35
sp|Q186F8|THIE_PEPD6 Thiamine-phosphate synthase OS=Peptoclostridium difficile (strain 630) GN=thiE PE=3 SV=1 13 216 4.0E-35
sp|Q6FAS9|THIM_ACIAD Hydroxyethylthiazole kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=thiM PE=3 SV=1 236 482 5.0E-35
sp|A1VBV4|THIM_DESVV Hydroxyethylthiazole kinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=thiM PE=3 SV=1 235 482 6.0E-35
sp|Q9LIQ4|THIM_ARATH Hydroxyethylthiazole kinase OS=Arabidopsis thaliana GN=THIM PE=1 SV=1 238 486 8.0E-35
sp|A4VUB1|THIM_STRSY Hydroxyethylthiazole kinase OS=Streptococcus suis (strain 05ZYH33) GN=thiM PE=3 SV=1 235 490 1.0E-34
sp|Q890C2|THIM_LACPL Hydroxyethylthiazole kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=thiM PE=3 SV=1 233 479 2.0E-34
sp|Q2RGI8|THIE_MOOTA Thiamine-phosphate synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=thiE PE=3 SV=1 26 207 2.0E-34
sp|B5XP99|THIM_KLEP3 Hydroxyethylthiazole kinase OS=Klebsiella pneumoniae (strain 342) GN=thiM PE=3 SV=1 242 481 2.0E-34
sp|Q1ASC4|THIM_RUBXD Hydroxyethylthiazole kinase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=thiM PE=3 SV=1 235 471 2.0E-34
sp|Q729I7|THIM_DESVH Hydroxyethylthiazole kinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=thiM PE=3 SV=1 235 482 2.0E-34
sp|C1DCM3|THIE_LARHH Thiamine-phosphate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=thiE PE=3 SV=1 7 224 2.0E-34
sp|Q466J5|THIE_METBF Thiamine-phosphate synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=thiE PE=3 SV=1 8 229 2.0E-34
sp|P72965|THIE_SYNY3 Thiamine-phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=thiE PE=3 SV=1 12 226 2.0E-34
sp|A6TBJ8|THIM_KLEP7 Hydroxyethylthiazole kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=thiM PE=3 SV=1 242 481 6.0E-34
sp|Q3K1L7|THIM_STRA1 Hydroxyethylthiazole kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thiM PE=3 SV=1 235 483 8.0E-34
sp|Q8TMD6|THIE_METAC Thiamine-phosphate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thiE PE=3 SV=1 8 226 1.0E-33
sp|Q8E5X0|THIM_STRA3 Hydroxyethylthiazole kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thiM PE=3 SV=1 235 483 1.0E-33
sp|C0QR82|THIE_PERMH Thiamine-phosphate synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=thiE PE=3 SV=1 8 211 1.0E-33
sp|Q03NR9|THIM_LACBA Hydroxyethylthiazole kinase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=thiM PE=3 SV=1 242 479 2.0E-33
sp|K7VCB9|THIM_MAIZE Hydroxyethylthiazole kinase OS=Zea mays GN=THIM PE=1 SV=1 243 486 2.0E-33
sp|Q87JW8|THIE_VIBPA Thiamine-phosphate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiE PE=3 SV=1 14 224 2.0E-33
sp|A7N7S3|THIE_VIBCB Thiamine-phosphate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=thiE PE=3 SV=1 14 223 2.0E-33
sp|A8GHT4|THIM_SERP5 Hydroxyethylthiazole kinase OS=Serratia proteamaculans (strain 568) GN=thiM PE=3 SV=1 235 483 2.0E-33
sp|Q8E093|THIM_STRA5 Hydroxyethylthiazole kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thiM PE=3 SV=1 235 483 2.0E-33
sp|Q18GX8|THIM_HALWD Hydroxyethylthiazole kinase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=thiM PE=3 SV=1 235 477 3.0E-33
sp|Q8PS49|THIE_METMA Thiamine-phosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=thiE PE=3 SV=1 11 226 4.0E-33
sp|Q5L6R4|THIM_CHLAB Hydroxyethylthiazole kinase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=thiM PE=3 SV=1 231 480 4.0E-33
sp|Q830K5|THIE_ENTFA Thiamine-phosphate synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=thiE PE=3 SV=1 9 233 4.0E-33
sp|B0RGG4|THIM_CLAMS Hydroxyethylthiazole kinase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=thiM PE=3 SV=1 237 479 6.0E-33
sp|Q5KZU0|THIE_GEOKA Thiamine-phosphate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=thiE PE=3 SV=1 7 209 6.0E-33
sp|Q8U192|THIE_PYRFU Thiamine-phosphate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=thiE PE=1 SV=1 9 230 9.0E-33
sp|Q5M731|TPS1L_ARATH Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic OS=Arabidopsis thaliana GN=TH1 PE=1 SV=1 11 229 1.0E-32
sp|A4FX32|THIE_METM5 Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=thiE PE=3 SV=1 15 230 1.0E-32
sp|Q0AZ87|THIM_SYNWW Hydroxyethylthiazole kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thiM PE=3 SV=1 233 483 1.0E-32
sp|Q9UZQ5|THIE_PYRAB Thiamine-phosphate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=thiE PE=3 SV=1 9 222 3.0E-32
sp|Q3B4B1|THIE_CHLL7 Thiamine-phosphate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=thiE PE=3 SV=1 31 226 3.0E-32
sp|O48881|TPS1_BRANA Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic OS=Brassica napus GN=BTH1 PE=1 SV=1 11 229 3.0E-32
sp|Q2QWK9|TPS1_ORYSJ Probable thiamine biosynthetic bifunctional enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os12g0192500 PE=2 SV=2 14 224 4.0E-32
sp|O66833|THIE1_AQUAE Thiamine-phosphate synthase 1 OS=Aquifex aeolicus (strain VF5) GN=thiE1 PE=3 SV=1 10 231 4.0E-32
sp|P61413|THIE_METMP Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=thiE PE=3 SV=1 15 230 6.0E-32
sp|Q0TQV3|THIM_CLOP1 Hydroxyethylthiazole kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=thiM PE=3 SV=1 243 486 7.0E-32
sp|Q3IP34|THIE_NATPD Thiamine-phosphate synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=thiE PE=3 SV=1 11 234 8.0E-32
sp|B9KL69|THIM_RHOSK Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=thiM PE=3 SV=1 243 480 8.0E-32
sp|A3PM38|THIM_RHOS1 Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=thiM PE=3 SV=1 243 480 8.0E-32
sp|C1CD69|THIM1_STRZJ Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain JJA) GN=thiM1 PE=3 SV=1 235 482 1.0E-31
sp|Q3J061|THIM_RHOS4 Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=thiM PE=3 SV=1 243 482 1.0E-31
sp|A9AAG9|THIE_METM6 Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=thiE PE=3 SV=1 15 230 1.0E-31
sp|C0QAT7|THIM_DESAH Hydroxyethylthiazole kinase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=thiM PE=3 SV=1 237 484 2.0E-31
sp|B2IN99|THIM1_STRPS Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain CGSP14) GN=thiM1 PE=3 SV=2 235 482 2.0E-31
sp|B8ZN14|THIM1_STRPJ Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thiM1 PE=3 SV=1 235 482 2.0E-31
sp|P66921|THIE2_STRR6 Thiamine-phosphate synthase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thiE2 PE=3 SV=1 14 224 4.0E-31
sp|P66920|THIE2_STRPN Thiamine-phosphate synthase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thiE2 PE=3 SV=1 14 224 4.0E-31
sp|Q0IC17|THIE_SYNS3 Thiamine-phosphate synthase OS=Synechococcus sp. (strain CC9311) GN=thiE PE=3 SV=2 30 226 5.0E-31
sp|C1C666|THIM1_STRP7 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain 70585) GN=thiM1 PE=3 SV=1 235 482 5.0E-31
sp|Q9HIQ4|THIE_THEAC Thiamine-phosphate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thiE PE=3 SV=1 14 231 6.0E-31
sp|B4U6B2|THIE_HYDS0 Thiamine-phosphate synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=thiE PE=3 SV=1 8 230 6.0E-31
sp|A4SEP8|THIE_CHLPM Thiamine-phosphate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=thiE PE=3 SV=1 31 231 6.0E-31
sp|A5I421|THIM2_CLOBH Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thiM2 PE=3 SV=2 233 480 8.0E-31
sp|A7FVR9|THIM2_CLOB1 Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thiM2 PE=3 SV=1 233 480 8.0E-31
sp|C1CQI2|THIM1_STRZT Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=thiM1 PE=3 SV=1 235 482 8.0E-31
sp|C1CJG8|THIM1_STRZP Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain P1031) GN=thiM1 PE=3 SV=1 235 482 8.0E-31
sp|Q8DQK5|THIM1_STRR6 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thiM1 PE=3 SV=2 235 482 8.0E-31
sp|Q04LH9|THIM1_STRP2 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=thiM1 PE=3 SV=1 235 482 8.0E-31
sp|Q21VL5|THIE_RHOFT Thiamine-phosphate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=thiE PE=3 SV=1 14 222 9.0E-31
sp|Q97RS6|THIM1_STRPN Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thiM1 PE=3 SV=1 235 482 1.0E-30
sp|B1IAN9|THIM1_STRPI Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=thiM1 PE=3 SV=1 235 482 1.0E-30
sp|O58878|THIE_PYRHO Thiamine-phosphate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=thiE PE=3 SV=2 12 222 1.0E-30
sp|Q8DHK2|THIE_THEEB Thiamine-phosphate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=thiE PE=3 SV=2 1 226 2.0E-30
sp|Q0W1L8|THIE_METAR Thiamine-phosphate synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=thiE PE=3 SV=1 14 226 2.0E-30
sp|B7GQ20|THIM_BIFLS Hydroxyethylthiazole kinase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=thiM PE=3 SV=1 235 482 3.0E-30
sp|A6VG83|THIE_METM7 Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=thiE PE=3 SV=1 15 230 3.0E-30
sp|A4WQ25|THIM_RHOS5 Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=thiM PE=3 SV=1 238 480 3.0E-30
sp|Q162K5|THIM_ROSDO Hydroxyethylthiazole kinase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=thiM PE=3 SV=1 238 479 3.0E-30
sp|C1AE25|THIM_GEMAT Hydroxyethylthiazole kinase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=thiM PE=3 SV=1 241 479 3.0E-30
sp|P39594|THIE_BACSU Thiamine-phosphate synthase OS=Bacillus subtilis (strain 168) GN=thiE PE=1 SV=1 13 226 4.0E-30
sp|A7IGG9|THIE_XANP2 Thiamine-phosphate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=thiE PE=3 SV=1 8 227 4.0E-30
sp|A3CS46|THIM_METMJ Hydroxyethylthiazole kinase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=thiM PE=3 SV=1 213 479 4.0E-30
sp|A5WDP0|THIE_PSYWF Thiamine-phosphate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=thiE PE=3 SV=1 13 224 5.0E-30
sp|Q0STA1|THIE_CLOPS Thiamine-phosphate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=thiE PE=3 SV=1 13 228 6.0E-30
sp|A4IN28|THIE_GEOTN Thiamine-phosphate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=thiE PE=3 SV=1 7 209 6.0E-30
sp|O28205|THIE_ARCFU Thiamine-phosphate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thiE PE=3 SV=1 12 228 6.0E-30
sp|A2RKJ5|THIM_LACLM Hydroxyethylthiazole kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=thiM PE=3 SV=1 234 481 9.0E-30
sp|Q03YX1|THIM1_LEUMM Hydroxyethylthiazole kinase 1 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=thiM1 PE=3 SV=1 235 482 9.0E-30
sp|C3KZ28|THIM2_CLOB6 Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thiM2 PE=3 SV=1 233 478 1.0E-29
sp|B1IHH3|THIM2_CLOBK Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Okra / Type B1) GN=thiM2 PE=3 SV=1 233 478 1.0E-29
sp|P61411|THIE_GEOSL Putative thiamine-phosphate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thiE PE=3 SV=1 9 226 1.0E-29
sp|B9KD06|THIM_CAMLR Hydroxyethylthiazole kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=thiM PE=3 SV=1 235 479 1.0E-29
sp|B5E320|THIM1_STRP4 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=thiM1 PE=3 SV=1 243 482 1.0E-29
sp|C1FR28|THIM2_CLOBJ Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thiM2 PE=3 SV=1 233 478 1.0E-29
sp|B2GBV7|THIM_LACF3 Hydroxyethylthiazole kinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=thiM PE=3 SV=1 231 479 2.0E-29
sp|Q2S2A8|THIE_SALRD Thiamine-phosphate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=thiE PE=3 SV=1 2 229 2.0E-29
sp|A8FIR6|THIE_BACP2 Thiamine-phosphate synthase OS=Bacillus pumilus (strain SAFR-032) GN=thiE PE=3 SV=1 12 191 2.0E-29
sp|A4W0K2|THIM_STRS2 Hydroxyethylthiazole kinase OS=Streptococcus suis (strain 98HAH33) GN=thiM PE=3 SV=1 235 441 2.0E-29
sp|Q0AFV0|THIE_NITEC Thiamine-phosphate synthase OS=Nitrosomonas eutropha (strain C91) GN=thiE PE=3 SV=1 21 222 2.0E-29
sp|B2J6F7|THIE_NOSP7 Thiamine-phosphate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=thiE PE=3 SV=1 4 226 3.0E-29
sp|A7GFJ3|THIM2_CLOBL Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thiM2 PE=3 SV=1 233 478 3.0E-29
sp|Q2FM63|THIE_METHJ Thiamine-phosphate synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=thiE PE=3 SV=1 10 229 4.0E-29
sp|Q18GX9|THIE_HALWD Thiamine-phosphate synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=thiE PE=3 SV=1 15 232 4.0E-29
sp|C4XIJ2|THIE_DESMR Thiamine-phosphate synthase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=thiE PE=3 SV=1 7 222 4.0E-29
sp|Q02YS4|THIM_LACLS Hydroxyethylthiazole kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=thiM PE=3 SV=1 234 488 4.0E-29
sp|Q67T51|THIME_SYMTH Thiamine biosynthesis bifunctional protein ThiM/ThiE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thiM/thiE PE=3 SV=1 236 479 5.0E-29
sp|Q8NQH0|THIM_CORGL Hydroxyethylthiazole kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=thiM PE=3 SV=1 238 482 6.0E-29
sp|A5CSW0|THIM_CLAM3 Hydroxyethylthiazole kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=thiM PE=3 SV=1 238 479 6.0E-29
sp|Q8G7X0|THIM_BIFLO Hydroxyethylthiazole kinase OS=Bifidobacterium longum (strain NCC 2705) GN=thiM PE=3 SV=1 235 482 7.0E-29
sp|Q7V0I3|THIE_PROMP Thiamine-phosphate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=thiE PE=3 SV=1 13 226 7.0E-29
sp|A1W068|THIE_CAMJJ Thiamine-phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=thiE PE=3 SV=1 7 230 8.0E-29
sp|A8FMD4|THIE_CAMJ8 Thiamine-phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=thiE PE=3 SV=1 7 230 8.0E-29
sp|Q5V0G6|THIE_HALMA Thiamine-phosphate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=thiE PE=3 SV=1 10 209 9.0E-29
sp|B1HX34|THIE_LYSSC Thiamine-phosphate synthase OS=Lysinibacillus sphaericus (strain C3-41) GN=thiE PE=3 SV=1 8 230 9.0E-29
sp|B3DQ80|THIM_BIFLD Hydroxyethylthiazole kinase OS=Bifidobacterium longum (strain DJO10A) GN=thiM PE=3 SV=1 235 482 9.0E-29
sp|B1KW01|THIM1_CLOBM Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thiM1 PE=3 SV=1 233 480 1.0E-28
sp|Q9RGS5|THIE_STACT Thiamine-phosphate synthase OS=Staphylococcus carnosus (strain TM300) GN=thiE PE=3 SV=1 11 224 1.0E-28
sp|P61422|THIED_GEOSL Thiamine biosynthesis bifunctional protein ThiED OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thiDE PE=3 SV=1 14 468 2.0E-28
sp|A6UPE6|THIE_METVS Thiamine-phosphate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=thiE PE=3 SV=1 34 230 2.0E-28
sp|Q8XKQ7|THIM_CLOPE Hydroxyethylthiazole kinase OS=Clostridium perfringens (strain 13 / Type A) GN=thiM PE=3 SV=1 243 486 2.0E-28
sp|Q9CG46|THIM_LACLA Hydroxyethylthiazole kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=thiM PE=3 SV=1 234 488 2.0E-28
sp|Q8XKQ8|THIE_CLOPE Thiamine-phosphate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=thiE PE=3 SV=1 13 228 2.0E-28
sp|Q8FTH7|THIM_COREF Hydroxyethylthiazole kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiM PE=3 SV=1 238 484 3.0E-28
sp|Q9PNL3|THIE_CAMJE Thiamine-phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=thiE PE=3 SV=1 7 230 3.0E-28
sp|B1MX61|THIM_LEUCK Hydroxyethylthiazole kinase OS=Leuconostoc citreum (strain KM20) GN=thiM PE=3 SV=1 238 488 3.0E-28
sp|Q5HU23|THIE_CAMJR Thiamine-phosphate synthase OS=Campylobacter jejuni (strain RM1221) GN=thiE PE=3 SV=1 7 230 3.0E-28
sp|Q8YX72|THIE_NOSS1 Thiamine-phosphate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=thiE PE=3 SV=2 14 226 5.0E-28
sp|Q0TQV4|THIE_CLOP1 Thiamine-phosphate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=thiE PE=3 SV=1 13 228 6.0E-28
sp|Q8RI59|THIE_FUSNN Thiamine-phosphate synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=thiE PE=3 SV=1 11 226 6.0E-28
sp|Q8ESZ3|THIE_OCEIH Thiamine-phosphate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thiE PE=3 SV=1 28 222 8.0E-28
sp|C4XIJ3|THIM_DESMR Hydroxyethylthiazole kinase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=thiM PE=3 SV=1 235 485 8.0E-28
sp|B2G7Q2|THIM_LACRJ Hydroxyethylthiazole kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=thiM PE=3 SV=1 226 479 8.0E-28
sp|A5VK99|THIM_LACRD Hydroxyethylthiazole kinase OS=Lactobacillus reuteri (strain DSM 20016) GN=thiM PE=3 SV=1 226 479 8.0E-28
sp|Q0STA0|THIM_CLOPS Hydroxyethylthiazole kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=thiM PE=3 SV=1 243 479 9.0E-28
sp|Q7U5U1|THIE_SYNPX Thiamine-phosphate synthase OS=Synechococcus sp. (strain WH8102) GN=thiE PE=3 SV=1 5 226 1.0E-27
sp|A3M6H8|THIM_ACIBT Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=thiM PE=3 SV=2 220 482 1.0E-27
sp|B0V782|THIM_ACIBY Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain AYE) GN=thiM PE=3 SV=1 220 482 1.0E-27
sp|B7IAM8|THIM_ACIB5 Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain AB0057) GN=thiM PE=3 SV=1 220 482 1.0E-27
sp|B7H160|THIM_ACIB3 Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain AB307-0294) GN=thiM PE=3 SV=1 220 482 1.0E-27
sp|Q7VAV5|THIE_PROMA Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=thiE PE=3 SV=1 12 228 2.0E-27
sp|B5YA97|THIE_DICT6 Thiamine-phosphate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=thiE PE=3 SV=1 11 223 2.0E-27
sp|Q1MRJ6|THIE_LAWIP Thiamine-phosphate synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=thiE PE=3 SV=1 10 227 3.0E-27
sp|B3W783|THIE_LACCB Thiamine-phosphate synthase OS=Lactobacillus casei (strain BL23) GN=thiE PE=3 SV=1 11 232 3.0E-27
sp|Q7NNK8|THIE_GLOVI Thiamine-phosphate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=thiE PE=3 SV=2 14 214 4.0E-27
sp|B2HTR5|THIM_ACIBC Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain ACICU) GN=thiM PE=3 SV=1 220 482 5.0E-27
sp|A7ZA58|THIE_BACMF Thiamine-phosphate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=thiE PE=3 SV=1 13 229 5.0E-27
sp|Q03CB2|THIE_LACC3 Thiamine-phosphate synthase OS=Lactobacillus casei (strain ATCC 334) GN=thiE PE=3 SV=1 11 232 6.0E-27
sp|Q97RS5|THIE1_STRPN Thiamine-phosphate synthase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thiE1 PE=3 SV=1 28 222 7.0E-27
sp|A4W0K4|THIE_STRS2 Thiamine-phosphate synthase OS=Streptococcus suis (strain 98HAH33) GN=thiE PE=3 SV=1 13 223 7.0E-27
sp|Q8AA13|THIE_BACTN Thiamine-phosphate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=thiE PE=3 SV=1 37 236 9.0E-27
sp|Q8E5W9|THIE_STRA3 Thiamine-phosphate synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thiE PE=3 SV=1 28 233 1.0E-26
sp|Q8FTH8|THIED_COREF Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiED PE=3 SV=1 11 431 1.0E-26
sp|Q6GEY4|THIE_STAAR Thiamine-phosphate synthase OS=Staphylococcus aureus (strain MRSA252) GN=thiE PE=3 SV=1 13 209 1.0E-26
sp|Q82UQ7|THIE_NITEU Thiamine-phosphate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=thiE PE=3 SV=1 21 222 2.0E-26
sp|B0S0L6|THIM_FINM2 Hydroxyethylthiazole kinase OS=Finegoldia magna (strain ATCC 29328) GN=thiM PE=3 SV=1 231 483 2.0E-26
sp|B0VM84|THIM_ACIBS Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain SDF) GN=thiM PE=3 SV=1 220 482 2.0E-26
sp|Q2YUL2|THIE_STAAB Thiamine-phosphate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thiE PE=3 SV=1 13 209 3.0E-26
sp|Q7V8I3|THIE_PROMM Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=thiE PE=3 SV=1 5 226 3.0E-26
sp|A4QE51|THIM_CORGB Hydroxyethylthiazole kinase OS=Corynebacterium glutamicum (strain R) GN=thiM PE=3 SV=1 238 482 3.0E-26
sp|A9AZD9|THIE_HERA2 Thiamine-phosphate synthase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=thiE PE=3 SV=1 9 224 3.0E-26
sp|B0SMR9|THIE_LEPBP Thiamine-phosphate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=thiE PE=3 SV=1 14 222 4.0E-26
sp|B0SE83|THIE_LEPBA Thiamine-phosphate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=thiE PE=3 SV=1 14 222 4.0E-26
sp|B8E358|THIE_DICTD Thiamine-phosphate synthase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=thiE PE=3 SV=1 11 226 5.0E-26
sp|Q3JDH3|THIE_NITOC Thiamine-phosphate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=thiE PE=3 SV=1 14 233 5.0E-26
sp|B5Y6I1|THIE_COPPD Thiamine-phosphate synthase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=thiE PE=3 SV=1 37 232 6.0E-26
sp|Q5LCA7|THIE_BACFN Thiamine-phosphate synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=thiE PE=3 SV=1 37 224 7.0E-26
sp|Q8KD79|THIE_CHLTE Thiamine-phosphate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=thiE PE=3 SV=1 37 228 7.0E-26
sp|Q8NVH5|THIE_STAAW Thiamine-phosphate synthase OS=Staphylococcus aureus (strain MW2) GN=thiE PE=3 SV=1 13 209 7.0E-26
sp|Q6G7L9|THIE_STAAS Thiamine-phosphate synthase OS=Staphylococcus aureus (strain MSSA476) GN=thiE PE=3 SV=1 13 209 7.0E-26
sp|Q3AL68|THIE_SYNSC Thiamine-phosphate synthase OS=Synechococcus sp. (strain CC9605) GN=thiE PE=3 SV=1 5 226 8.0E-26
sp|A0AFC5|THIE_LISW6 Thiamine-phosphate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=thiE PE=3 SV=1 11 223 8.0E-26
sp|P66919|THIE_STAAN Thiamine-phosphate synthase OS=Staphylococcus aureus (strain N315) GN=thiE PE=1 SV=1 13 209 8.0E-26
sp|P66918|THIE_STAAM Thiamine-phosphate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|A6QIT5|THIE_STAAE Thiamine-phosphate synthase OS=Staphylococcus aureus (strain Newman) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|Q5HEA8|THIE_STAAC Thiamine-phosphate synthase OS=Staphylococcus aureus (strain COL) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|A5IUN7|THIE_STAA9 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain JH9) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|Q2FWG3|THIE_STAA8 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|Q2FF35|THIE_STAA3 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain USA300) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|A6U3H7|THIE_STAA2 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain JH1) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|A7X4S8|THIE_STAA1 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thiE PE=3 SV=1 13 209 8.0E-26
sp|Q8E092|THIE_STRA5 Thiamine-phosphate synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thiE PE=3 SV=1 28 233 9.0E-26
sp|Q3K1L6|THIE_STRA1 Thiamine-phosphate synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thiE PE=3 SV=1 28 233 9.0E-26
sp|Q8DQK4|THIE1_STRR6 Thiamine-phosphate synthase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thiE1 PE=3 SV=1 28 222 9.0E-26
sp|B3QNM2|THIE_CHLP8 Thiamine-phosphate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=thiE PE=3 SV=1 37 226 2.0E-25
sp|Q723Y9|THIE_LISMF Thiamine-phosphate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=thiE PE=3 SV=1 9 222 4.0E-25
sp|B8DSX7|THIM_BIFA0 Hydroxyethylthiazole kinase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=thiM PE=3 SV=1 227 482 5.0E-25
sp|A8M9N4|THIE_CALMQ Thiamine-phosphate synthase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=thiE PE=3 SV=1 9 224 5.0E-25
sp|A1BGM7|THIE_CHLPD Thiamine-phosphate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=thiE PE=3 SV=1 37 228 5.0E-25
sp|A5GMH7|THIE_SYNPW Thiamine-phosphate synthase OS=Synechococcus sp. (strain WH7803) GN=thiE PE=3 SV=1 5 223 6.0E-25
sp|Q8YA44|THIE_LISMO Thiamine-phosphate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=thiE PE=3 SV=1 9 222 7.0E-25
sp|A5D4K4|THIE_PELTS Thiamine-phosphate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=thiE PE=3 SV=1 28 226 7.0E-25
sp|Q03GM4|THIE_PEDPA Thiamine-phosphate synthase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=thiE PE=3 SV=1 13 213 8.0E-25
sp|Q92EW5|THIE_LISIN Thiamine-phosphate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=thiE PE=3 SV=1 9 222 1.0E-24
sp|Q2Y5Q6|THIE_NITMU Thiamine-phosphate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=thiE PE=3 SV=1 21 222 2.0E-24
sp|Q3SFU7|THIE_THIDA Thiamine-phosphate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=thiE PE=3 SV=1 14 222 3.0E-24
sp|C1KZ34|THIE_LISMC Thiamine-phosphate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=thiE PE=3 SV=1 9 222 3.0E-24
sp|A2CB21|THIE_PROM3 Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=thiE PE=3 SV=1 12 226 4.0E-24
sp|Q5P6J5|THIE_AROAE Thiamine-phosphate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=thiE PE=3 SV=1 14 221 5.0E-24
sp|Q49Z39|THIE_STAS1 Thiamine-phosphate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thiE PE=3 SV=1 24 226 7.0E-24
sp|A2BSJ5|THIE_PROMS Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain AS9601) GN=thiE PE=3 SV=1 41 219 8.0E-24
sp|Q64TA1|THIE_BACFR Thiamine-phosphate synthase OS=Bacteroides fragilis (strain YCH46) GN=thiE PE=3 SV=1 37 224 8.0E-24
sp|Q0I131|THIE_HAES1 Thiamine-phosphate synthase OS=Haemophilus somnus (strain 129Pt) GN=thiE PE=3 SV=1 29 212 8.0E-24
sp|Q5SKG9|THIE_THET8 Thiamine-phosphate synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=thiE PE=3 SV=1 14 222 1.0E-23
sp|Q72KL8|THIE_THET2 Thiamine-phosphate synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=thiE PE=3 SV=1 14 222 1.0E-23
sp|Q6KZH9|THIE_PICTO Thiamine-phosphate synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=thiE PE=3 SV=1 14 230 1.0E-23
sp|B3ED41|THIE_CHLL2 Thiamine-phosphate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=thiE PE=3 SV=1 27 160 1.0E-23
sp|B8DET0|THIE_LISMH Thiamine-phosphate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=thiE PE=3 SV=1 9 222 2.0E-23
sp|A1TYG6|THIE_MARHV Thiamine-phosphate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=thiE PE=3 SV=1 7 191 2.0E-23
sp|Q8UAS9|THIM_AGRFC Probable hydroxyethylthiazole kinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=thiM PE=3 SV=1 234 482 3.0E-23
sp|C1A163|THIM_RHOE4 Hydroxyethylthiazole kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=thiM PE=3 SV=1 235 486 4.0E-23
sp|Q9ZL01|THIE_HELPJ Thiamine-phosphate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thiE PE=3 SV=1 27 225 4.0E-23
sp|P57930|THIE_PASMU Thiamine-phosphate synthase OS=Pasteurella multocida (strain Pm70) GN=thiE PE=3 SV=1 1 223 7.0E-23
sp|A1A2J2|THIM_BIFAA Hydroxyethylthiazole kinase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=thiM PE=3 SV=1 227 482 7.0E-23
sp|Q5L6R5|THIE_CHLAB Thiamine-phosphate synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=thiE PE=3 SV=1 25 189 8.0E-23
sp|Q1GXW1|THIE_METFK Thiamine-phosphate synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=thiE PE=3 SV=1 21 222 9.0E-23
sp|B7GKQ8|THIE_ANOFW Thiamine-phosphate synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=thiE PE=3 SV=1 13 229 1.0E-22
sp|Q824E9|THIE_CHLCV Thiamine-phosphate synthase OS=Chlamydophila caviae (strain GPIC) GN=thiE PE=3 SV=1 28 191 1.0E-22
sp|B3GX82|THIE_ACTP7 Thiamine-phosphate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=thiE PE=3 SV=1 27 223 3.0E-22
sp|Q9CG48|THIE_LACLA Thiamine-phosphate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=thiE PE=3 SV=1 29 214 3.0E-22
sp|A7IA09|THIE_METB6 Thiamine-phosphate synthase OS=Methanoregula boonei (strain 6A8) GN=thiE PE=3 SV=1 14 222 4.0E-22
sp|A6GWR9|THIE_FLAPJ Thiamine-phosphate synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=thiE PE=3 SV=1 34 222 6.0E-22
sp|P71350|THIE_HAEIN Thiamine-phosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiE PE=1 SV=1 27 222 1.0E-21
sp|A2RKJ7|THIE_LACLM Thiamine-phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=thiE PE=3 SV=1 7 229 1.0E-21
sp|Q63L73|THIM_BURPS Hydroxyethylthiazole kinase OS=Burkholderia pseudomallei (strain K96243) GN=thiM PE=3 SV=1 238 424 2.0E-21
sp|A3NJS6|THIM_BURP6 Hydroxyethylthiazole kinase OS=Burkholderia pseudomallei (strain 668) GN=thiM PE=3 SV=2 238 424 2.0E-21
sp|A3P5E2|THIM_BURP0 Hydroxyethylthiazole kinase OS=Burkholderia pseudomallei (strain 1106a) GN=thiM PE=3 SV=2 238 424 2.0E-21
sp|Q8UAS8|THIE_AGRFC Thiamine-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=thiE PE=3 SV=2 41 233 2.0E-21
sp|A4XG66|THIE_CALS8 Thiamine-phosphate synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=thiE PE=3 SV=2 28 226 2.0E-21
sp|Q2T5T2|THIM_BURTA Hydroxyethylthiazole kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=thiM PE=3 SV=1 238 424 2.0E-21
sp|Q3JME7|THIM_BURP1 Hydroxyethylthiazole kinase OS=Burkholderia pseudomallei (strain 1710b) GN=thiM PE=3 SV=2 238 424 3.0E-21
sp|A5UA71|THIE_HAEIE Thiamine-phosphate synthase OS=Haemophilus influenzae (strain PittEE) GN=thiE PE=3 SV=1 27 222 4.0E-21
sp|Q4QNC6|THIE_HAEI8 Thiamine-phosphate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=thiE PE=3 SV=1 27 222 4.0E-21
sp|B8GLE3|THIE_THISH Thiamine-phosphate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=thiE PE=3 SV=1 14 224 5.0E-21
sp|B9MN52|THIE_CALBD Thiamine-phosphate synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=thiE PE=3 SV=1 28 230 5.0E-21
sp|Q1CT27|THIE_HELPH Thiamine-phosphate synthase OS=Helicobacter pylori (strain HPAG1) GN=thiE PE=3 SV=1 30 225 6.0E-21
sp|Q02YS6|THIE_LACLS Thiamine-phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=thiE PE=3 SV=1 8 229 6.0E-21
sp|O25514|THIE_HELPY Thiamine-phosphate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thiE PE=3 SV=1 30 225 7.0E-21
sp|Q38ZM1|THIE_LACSS Thiamine-phosphate synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=thiE PE=3 SV=1 26 218 9.0E-21
sp|Q4L7X3|THIE_STAHJ Thiamine-phosphate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=thiE PE=3 SV=1 13 209 1.0E-20
sp|A5UGT0|THIE_HAEIG Thiamine-phosphate synthase OS=Haemophilus influenzae (strain PittGG) GN=thiE PE=3 SV=1 27 222 1.0E-20
sp|A6L645|THIE_BACV8 Thiamine-phosphate synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=thiE PE=3 SV=1 37 224 1.0E-20
sp|A5FJJ1|THIE_FLAJ1 Thiamine-phosphate synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=thiE PE=3 SV=1 28 214 2.0E-20
sp|Q67T51|THIME_SYMTH Thiamine biosynthesis bifunctional protein ThiM/ThiE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thiM/thiE PE=3 SV=1 13 155 1.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0052855 ADP-dependent NAD(P)H-hydrate dehydratase activity Yes
GO:0004417 hydroxyethylthiazole kinase activity Yes
GO:0009228 thiamine biosynthetic process Yes
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0006066 alcohol metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0034308 primary alcohol metabolic process No
GO:0008152 metabolic process No
GO:0016301 kinase activity No
GO:0009058 biosynthetic process No
GO:0006766 vitamin metabolic process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0046165 alcohol biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016835 carbon-oxygen lyase activity No
GO:0044281 small molecule metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0006790 sulfur compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0016740 transferase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034309 primary alcohol biosynthetic process No
GO:0016829 lyase activity No
GO:0003674 molecular_function No
GO:0006772 thiamine metabolic process No
GO:0009987 cellular process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0016836 hydro-lyase activity No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0042723 thiamine-containing compound metabolic process No
GO:0042724 thiamine-containing compound biosynthetic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0044272 sulfur compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4923
MSPWRAKKRIDCSVYLVTDSTPAVLGTRDLLSVVEEALRGGVTAVQLRDKKGQHEQMVATARALHALTSKFDVPL
LINDNVDVAVEVDCEGLHIGQDDMKLALARKMLGAGKIIGVSASTAAEAIAACRDGADYLGLGTVYATPTKKDTK
SIIGPRGVHDILAALAAAGFGSTPTVCIGGISTANAAAVLQQAQSPSKGLSGVAVVSAIMSAPDATAAASSLVST
VLKSLMPRVVKQISETKPLSHNMTNLVVQNFAANVALAVGASPIMSNLADEAPDLVGLDGALVVNMGTITPDGLQ
NLVRAVETYNRAGRPIVLDPVGVGATAVRREAVKQLLTQGHFEVIKGNASELLAVAGAIMVQRGVDSTATMSVAH
RAKLARDLARKQSCVVVLSGATDIVSDGRRTLRIDNGHELLGCITGSGCTLGTALSAALAVSPHDHLTAAVAATV
MFGIAAEKAAQDGKVGGPGTFVPVFIDQLYRIRKATEEHDFGWVASAKVDVVDVDDCNCPDV*
Coding >OphauG2|4923
ATGAGTCCATGGAGGGCCAAGAAACGCATCGACTGCAGCGTCTACCTGGTGACGGACTCGACGCCAGCGGTGCTC
GGGACGCGCGACCTGTTGAGCGTGGTGGAAGAGGCTCTCCGCGGAGGCGTGACGGCGGTGCAACTGCGCGATAAA
AAGGGCCAGCATGAGCAAATGGTGGCGACGGCGCGGGCCCTGCATGCCCTGACGAGCAAGTTTGATGTGCCGCTG
CTCATCAACGACAATGTCGACGTGGCTGTCGAGGTTGACTGCGAGGGCCTTCACATTGGCCAAGACGACATGAAG
TTGGCGCTGGCCAGGAAAATGCTGGGCGCTGGCAAGATTATTGGCGTCTCAGCCAGCACGGCAGCCGAGGCCATT
GCAGCGTGTCGAGACGGGGCCGACTATCTCGGCTTGGGCACCGTATATGCCACCCCAACGAAAAAAGACACAAAG
TCCATCATCGGCCCTCGGGGCGTACACGACATTCTCGCAGCGCTGGCTGCAGCTGGCTTCGGCTCTACGCCCACT
GTCTGCATCGGCGGCATCTCCACCGCCAATGCTGCCGCCGTCTTGCAACAGGCACAATCGCCCAGCAAAGGCCTC
TCGGGCGTGGCCGTGGTCAGCGCCATCATGTCGGCGCCTGATGCAACAGCCGCCGCGAGCAGCTTGGTGTCGACG
GTGCTGAAAAGCCTCATGCCTCGTGTGGTGAAGCAAATATCGGAAACGAAGCCCCTGTCACACAACATGACCAAC
CTGGTGGTACAAAACTTTGCCGCCAATGTTGCTCTGGCTGTTGGTGCAAGCCCAATAATGTCAAATTTGGCCGAC
GAAGCCCCAGATCTGGTGGGCCTCGACGGCGCCCTGGTGGTGAACATGGGCACCATTACTCCCGATGGCCTGCAG
AACCTTGTCCGAGCCGTCGAGACGTACAATCGGGCTGGGAGGCCGATTGTGCTTGATCCTGTCGGAGTGGGCGCC
ACGGCTGTTCGAAGAGAGGCGGTCAAGCAACTGCTGACACAAGGACACTTTGAAGTCATCAAGGGCAATGCTTCC
GAGCTGCTCGCCGTTGCTGGGGCAATCATGGTGCAGCGCGGCGTCGACTCAACAGCCACCATGAGCGTGGCGCAC
CGTGCAAAACTTGCTCGAGACCTTGCGCGCAAGCAGTCGTGCGTTGTTGTCCTGAGCGGGGCCACGGACATTGTC
AGCGATGGACGACGGACTCTACGCATCGACAATGGCCATGAGCTTCTCGGTTGCATTACCGGCTCCGGCTGTACT
CTCGGCACGGCCTTGAGCGCTGCTCTGGCCGTCTCTCCTCACGACCATCTTACTGCTGCCGTGGCAGCGACCGTC
ATGTTTGGCATTGCGGCTGAGAAGGCTGCCCAAGACGGTAAAGTCGGGGGTCCGGGGACCTTTGTCCCCGTCTTT
ATCGACCAGCTGTATAGAATCCGAAAAGCAACAGAGGAGCATGACTTTGGCTGGGTGGCGTCTGCCAAGGTGGAC
GTGGTTGACGTGGACGATTGCAACTGTCCAGACGTGTAA
Transcript >OphauG2|4923
ATGAGTCCATGGAGGGCCAAGAAACGCATCGACTGCAGCGTCTACCTGGTGACGGACTCGACGCCAGCGGTGCTC
GGGACGCGCGACCTGTTGAGCGTGGTGGAAGAGGCTCTCCGCGGAGGCGTGACGGCGGTGCAACTGCGCGATAAA
AAGGGCCAGCATGAGCAAATGGTGGCGACGGCGCGGGCCCTGCATGCCCTGACGAGCAAGTTTGATGTGCCGCTG
CTCATCAACGACAATGTCGACGTGGCTGTCGAGGTTGACTGCGAGGGCCTTCACATTGGCCAAGACGACATGAAG
TTGGCGCTGGCCAGGAAAATGCTGGGCGCTGGCAAGATTATTGGCGTCTCAGCCAGCACGGCAGCCGAGGCCATT
GCAGCGTGTCGAGACGGGGCCGACTATCTCGGCTTGGGCACCGTATATGCCACCCCAACGAAAAAAGACACAAAG
TCCATCATCGGCCCTCGGGGCGTACACGACATTCTCGCAGCGCTGGCTGCAGCTGGCTTCGGCTCTACGCCCACT
GTCTGCATCGGCGGCATCTCCACCGCCAATGCTGCCGCCGTCTTGCAACAGGCACAATCGCCCAGCAAAGGCCTC
TCGGGCGTGGCCGTGGTCAGCGCCATCATGTCGGCGCCTGATGCAACAGCCGCCGCGAGCAGCTTGGTGTCGACG
GTGCTGAAAAGCCTCATGCCTCGTGTGGTGAAGCAAATATCGGAAACGAAGCCCCTGTCACACAACATGACCAAC
CTGGTGGTACAAAACTTTGCCGCCAATGTTGCTCTGGCTGTTGGTGCAAGCCCAATAATGTCAAATTTGGCCGAC
GAAGCCCCAGATCTGGTGGGCCTCGACGGCGCCCTGGTGGTGAACATGGGCACCATTACTCCCGATGGCCTGCAG
AACCTTGTCCGAGCCGTCGAGACGTACAATCGGGCTGGGAGGCCGATTGTGCTTGATCCTGTCGGAGTGGGCGCC
ACGGCTGTTCGAAGAGAGGCGGTCAAGCAACTGCTGACACAAGGACACTTTGAAGTCATCAAGGGCAATGCTTCC
GAGCTGCTCGCCGTTGCTGGGGCAATCATGGTGCAGCGCGGCGTCGACTCAACAGCCACCATGAGCGTGGCGCAC
CGTGCAAAACTTGCTCGAGACCTTGCGCGCAAGCAGTCGTGCGTTGTTGTCCTGAGCGGGGCCACGGACATTGTC
AGCGATGGACGACGGACTCTACGCATCGACAATGGCCATGAGCTTCTCGGTTGCATTACCGGCTCCGGCTGTACT
CTCGGCACGGCCTTGAGCGCTGCTCTGGCCGTCTCTCCTCACGACCATCTTACTGCTGCCGTGGCAGCGACCGTC
ATGTTTGGCATTGCGGCTGAGAAGGCTGCCCAAGACGGTAAAGTCGGGGGTCCGGGGACCTTTGTCCCCGTCTTT
ATCGACCAGCTGTATAGAATCCGAAAAGCAACAGAGGAGCATGACTTTGGCTGGGTGGCGTCTGCCAAGGTGGAC
GTGGTTGACGTGGACGATTGCAACTGTCCAGACGTGTAA
Gene >OphauG2|4923
ATGAGTCCATGGAGGGCCAAGAAACGCATCGACTGCAGCGTCTACCTGGTGACGGACTCGACGCCAGCGGTGCTC
GGGACGCGCGACCTGTTGAGCGTGGTGGAAGAGGCTCTCCGCGGAGGCGTGACGGCGGTGCAACTGCGCGATAAA
AAGGGCCAGCATGAGCAAATGGTGGCGACGGCGCGGGCCCTGCATGCCCTGACGAGCAAGTTTGATGTGCCGCTG
CTCATCAACGACAATGTCGACGTGGCTGTCGAGGTTGACTGCGAGGGCCTTCACATTGGCCAAGACGACATGAGT
AGGCCGCCAGCCAGATTGCAGCTCATGGGCACTGCTAAGGACACGGGCAGAGTTGGCGCTGGCCAGGAAAATGCT
GGGCGCTGGCAAGATTATTGGCGTCTCAGCCAGCACGGCAGCCGAGGCCATTGCAGCGTGTCGAGACGGGGCCGA
CTATCTCGGCTTGGGCACCGTATATGCCACCCCAACGTCGGTTTCCCTTGTCAAGACTTGGACGCTTTGAATGCC
AATGTCAGCTATTGACCCTAAAACCCTTTTTTTCTTGTAGGAAAAAAGACACAAAGTCCATCATCGGCCCTCGGG
GCGTACACGACATTCTCGCAGCGCTGGCTGCAGCTGGCTTCGGCTCTACGCCCACTGTCTGCATCGGCGGCATCT
CCACCGCCAATGCTGCCGCCGTCTTGCAACAGGCACAATCGCCCAGCAAAGGCCTCTCGGGCGTGGCCGTGGTCA
GCGCCATCATGTCGGCGCCTGATGCAACAGCCGCCGCGAGCAGCTTGGTGTCGACGGTGCTGAAAAGCCTCATGC
CTCGTGTGGTGAAGCAAATATCGGAAACGAAGCCCCTGTCACACAACATGACCAACCTGGTAAGCTGTCTTGATG
CACGACGTGTGCGACGTGTTAATGGCGTTTGATTTGGCAAGGTGGTACAAAACTTTGCCGCCAATGTTGCTCTGG
CTGTTGGTGCAAGCCCAATAATGTCAAATTTGGCCGACGAAGCCCCAGATCTGGTGGGCCTCGACGGCGCCCTGG
TGGTGAACATGGGCACCATTACTCCCGATGGCCTGCAGAACCTTGTCCGAGCCGTCGAGACGTACAATCGGGCTG
GGAGGCCGATTGTGCTTGATCCTGTCGGGTGAGCAAAAGCCATCTGTTTGAAGCTGAGACGCACATGCTGAGTCG
ACGCAGAGTGGGCGCCACGGCTGTTCGAAGAGAGGCGGTCAAGCAACTGCTGACACAAGGACACTTTGAAGTCAT
CAAGGGCAATGCTTCCGAGCTGCTCGCCGTTGCTGGGGCAATCATGGTGCAGCGCGGCGTCGACTCAACAGCCAC
CATGAGCGTGGCGCACCGTGCAAAACTTGCTCGAGACCTTGCGCGCAAGCAGTCGTGCGTTGTTGTCCTGAGCGG
GGCCACGGACATTGTCAGCGATGGACGACGGACTCTACGCATCGACAATGGCCATGAGCTTCTCGGTTGCATTAC
CGGCTCCGGCTGTACTCTCGGCACGGCCTTGAGCGCTGCTCTGGCCGTCTCTCCTCACGACCATCTTACTGCTGC
CGTGGCAGCGACCGTCATGTTTGGCATTGCGGCTGAGAAGGCTGCCCAAGACGGTAAAGTCGGGGGTCCGGGGAC
CTTTGTCCCCGTCTTTATCGACCAGCTGTATAGAATCCGAAAAGCAACAGAGGAGCATGACTTTGGCTGGGTGGC
GTCTGCCAAGGTGGACGTGGTTGACGTGGACGATTGCAACTGTCCAGACGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail