Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4903
Gene name
LocationContig_426:9820..11143
Strand-
Gene length (bp)1323
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 2.5E-34 86 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 29 288 4.0E-54
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 29 288 2.0E-51
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 29 288 3.0E-51
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 29 288 3.0E-51
sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 29 287 3.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 29 288 4.0E-54
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 29 288 2.0E-51
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 29 288 3.0E-51
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 29 288 3.0E-51
sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 29 287 3.0E-48
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 29 288 5.0E-47
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 29 288 8.0E-46
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 26 236 3.0E-29
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 19 236 4.0E-25
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 19 236 4.0E-25
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 59 287 5.0E-23
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 32 262 4.0E-19
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 32 262 4.0E-19
sp|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR107W PE=3 SV=2 50 221 6.0E-15
sp|Q9XTR8|LIP1_CAEEL Lipase ZK262.3 OS=Caenorhabditis elegans GN=ZK262.3 PE=1 SV=1 74 286 3.0E-09
sp|Q6F358|PLA6_ORYSJ Phospholipase A1-II 6 OS=Oryza sativa subsp. japonica GN=Os05g0574000 PE=2 SV=1 86 220 4.0E-07
sp|A2WT96|PLA2_ORYSI Phospholipase A1-II 2 OS=Oryza sativa subsp. indica GN=OsI_03084 PE=3 SV=2 86 251 1.0E-06
sp|Q0JKT4|PLA2_ORYSJ Phospholipase A1-II 2 OS=Oryza sativa subsp. japonica GN=Os01g0651200 PE=2 SV=1 86 251 1.0E-06
sp|A2WTA0|PLA3_ORYSI Phospholipase A1-II 3 OS=Oryza sativa subsp. indica GN=OsI_03088 PE=3 SV=1 86 222 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4903
MSTYWKATLLAVCHLYLGALPAHGEKTPIDQALFDSFKRYTEISSAAYADECAEPPQAINITKRISNTKTDTQAF
LARDEQTNEWILAFRGSSSAKDFLIDLDSRLVPFETAGVTDCKDCKAHQGILKAWNSVSQETIAAVKAALAETPD
AKLTVTGHSLGATLASLATLSLVGSDVKVTATYTFGQPRTGNQVFADFADATIPAGKLFRVTHANDGVPQVFTAD
QGFQHHSTEFWQEDDSDDASKTFKCEGQEPQDCNNSVRGTGIGPGGRGLNAAHTKYAGIKVGAEICNSKDEGQGN
EDKEDEENVPDGDEKEDDDDDDDKNQGPETRAPFPPTLYTTP*
Coding >OphauG2|4903
ATGTCAACTTATTGGAAGGCGACTCTGTTGGCGGTTTGCCATCTTTACCTAGGAGCCTTGCCTGCTCATGGTGAA
AAGACACCAATCGATCAAGCCTTGTTCGACAGTTTCAAGCGCTACACGGAGATATCTTCAGCCGCTTACGCGGAT
GAGTGCGCTGAGCCGCCCCAGGCTATCAACATCACCAAACGCATCAGCAACACAAAGACGGACACACAGGCCTTT
CTAGCGAGAGATGAACAGACCAATGAGTGGATTCTAGCCTTTCGTGGCTCATCGAGCGCCAAGGACTTTCTCATC
GACTTGGATTCCAGGCTTGTGCCCTTTGAGACGGCAGGCGTGACAGACTGCAAAGACTGCAAGGCTCACCAAGGC
ATCCTCAAGGCTTGGAATTCAGTCTCGCAAGAGACCATTGCCGCAGTCAAGGCAGCCCTGGCGGAAACCCCAGAT
GCCAAGCTCACCGTGACAGGTCACTCTCTTGGTGCCACTCTGGCTTCCTTGGCAACCCTCTCCCTCGTGGGCTCA
GACGTCAAAGTAACTGCCACTTATACCTTTGGCCAGCCGCGGACAGGCAACCAGGTCTTTGCGGATTTCGCCGAT
GCGACTATTCCGGCGGGCAAACTCTTCCGCGTCACTCATGCCAATGACGGAGTGCCTCAAGTCTTTACTGCTGAC
CAAGGCTTTCAGCATCACTCGACTGAGTTTTGGCAAGAGGATGACTCGGACGATGCATCCAAGACGTTTAAATGT
GAAGGACAAGAACCCCAGGATTGTAACAACTCGGTCAGGGGAACCGGAATTGGCCCAGGAGGCCGTGGACTTAAT
GCTGCCCATACAAAGTACGCGGGAATCAAGGTTGGCGCCGAGATTTGTAACAGCAAAGACGAGGGCCAGGGAAAC
GAGGACAAGGAGGATGAAGAGAATGTACCAGATGGGGATGAAAAGGAAGACGACGACGACGACGACGACAAAAAT
CAGGGCCCAGAGACGAGAGCCCCATTTCCTCCTACCCTGTACACTACGCCATGA
Transcript >OphauG2|4903
ATGTCAACTTATTGGAAGGCGACTCTGTTGGCGGTTTGCCATCTTTACCTAGGAGCCTTGCCTGCTCATGGTGAA
AAGACACCAATCGATCAAGCCTTGTTCGACAGTTTCAAGCGCTACACGGAGATATCTTCAGCCGCTTACGCGGAT
GAGTGCGCTGAGCCGCCCCAGGCTATCAACATCACCAAACGCATCAGCAACACAAAGACGGACACACAGGCCTTT
CTAGCGAGAGATGAACAGACCAATGAGTGGATTCTAGCCTTTCGTGGCTCATCGAGCGCCAAGGACTTTCTCATC
GACTTGGATTCCAGGCTTGTGCCCTTTGAGACGGCAGGCGTGACAGACTGCAAAGACTGCAAGGCTCACCAAGGC
ATCCTCAAGGCTTGGAATTCAGTCTCGCAAGAGACCATTGCCGCAGTCAAGGCAGCCCTGGCGGAAACCCCAGAT
GCCAAGCTCACCGTGACAGGTCACTCTCTTGGTGCCACTCTGGCTTCCTTGGCAACCCTCTCCCTCGTGGGCTCA
GACGTCAAAGTAACTGCCACTTATACCTTTGGCCAGCCGCGGACAGGCAACCAGGTCTTTGCGGATTTCGCCGAT
GCGACTATTCCGGCGGGCAAACTCTTCCGCGTCACTCATGCCAATGACGGAGTGCCTCAAGTCTTTACTGCTGAC
CAAGGCTTTCAGCATCACTCGACTGAGTTTTGGCAAGAGGATGACTCGGACGATGCATCCAAGACGTTTAAATGT
GAAGGACAAGAACCCCAGGATTGTAACAACTCGGTCAGGGGAACCGGAATTGGCCCAGGAGGCCGTGGACTTAAT
GCTGCCCATACAAAGTACGCGGGAATCAAGGTTGGCGCCGAGATTTGTAACAGCAAAGACGAGGGCCAGGGAAAC
GAGGACAAGGAGGATGAAGAGAATGTACCAGATGGGGATGAAAAGGAAGACGACGACGACGACGACGACAAAAAT
CAGGGCCCAGAGACGAGAGCCCCATTTCCTCCTACCCTGTACACTACGCCATGA
Gene >OphauG2|4903
ATGTCAACTTATTGGAAGGCGACTCTGGTACGCCATCAAGTCGACTCTCTTTTGGTCCCTTCAGCTCTGGCTTTT
CCTCGATATCATTCCATCGCTCCATCTTTGCTGACTGGCCAAGTTGGCGGTTTGCCATCTTTACCTAGGAGCCTT
GCCTGCTCATGGTGAAAAGACACCAAGTATGACTGCTTCACCATTGACAACCATGACTGATGCTAACCTGGAGCC
TCCAGTCGATCAAGCCTTGTTCGACAGTTTCAAGCGCTACACGGAGATATCTTCAGCCGCTTACGCGGATGAGTG
CGCTGAGCCGCCCCAGGCTATCAACATCACCAAACGCATCAGCAACACAAAGACGGACACACAGGCCTTTCTAGC
GAGAGATGAACAGACCAATGAGTGGATTCTAGCCTTTCGTGGCTCATCGAGCGCCAAGGACTTTCTCATCGACTT
GGATTCCAGGCTTGTGCCCTTTGAGACGGCAGGCGTGACAGACTGCAAAGACTGCAAGGTAAAGCAGACTTGTTG
AAAATAACCAGCGTGTCAGTTCCGCCATGGCTCCATGACTGACACGAGAGGTCACGACAGGCTCACCAAGGCATC
CTCAAGGCTTGGAATTCAGTCTCGCAAGAGACCATTGCCGCAGTCAAGGCAGCCCTGGCGGAAACCCCAGATGCC
AAGCTCACCGTGACAGGTCACTCTCTTGGTGCCACTCTGGCTTCCTTGGCAACCCTCTCCCTCGTGGGCTCAGAC
GTCAAAGTAACTGCCACTTATACCTTTGGCCAGCCGCGGACAGGCAACCAGGTCTTTGCGGATTTCGCCGATGCG
ACTATTCCGGCGGGCAAACTCTTCCGCGTCACTCATGCCAATGACGGAGTGCCTCAAGTCTTTACTGCTGACCAA
GGCTTTCAGCATCACTCGACTGAGTTTTGGCAAGAGGATGACTCGGACGATGCATCCAAGACGTTTAAATGTGAA
GGACAAGAACCCCAGGTAAGAAATGTCCATTGAGAGCATACATCCATCGTTCCTCGTGGCCCTGGTCTGACTTGT
ATGATTTCCCAGGATTGTAACAACTCGGTCAGGGGAACCGGAATTGGCCCAGGAGGCCGTGGACTTAATGCTGCC
CATACAAAGTACGCGGGAATCAAGGTTGGCGCCGAGATTTGTAACAGCAAAGACGAGGGCCAGGGAAACGAGGAC
AAGGAGGATGAAGAGAATGTACCAGATGGGGATGAAAAGGAAGACGACGACGACGACGACGACAAAAATCAGGGC
CCAGAGACGAGAGCCCCATTTCCTCCTACCCTGTACACTACGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail