Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4898
Gene name
LocationContig_425:10160..12924
Strand-
Gene length (bp)2764
Transcript length (bp)2547
Coding sequence length (bp)2547
Protein length (aa) 849

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 7.3E-64 306 587
PF00698 Acyl_transf_1 Acyl transferase domain 1.2E-37 7 244
PF08242 Methyltransf_12 Methyltransferase domain 2.4E-08 768 848

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 4 845 2.0E-90
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 847 9.0E-83
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 3 848 5.0E-78
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 3 848 1.0E-77
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4 569 2.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 4 845 2.0E-90
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 847 9.0E-83
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 3 848 5.0E-78
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 3 848 1.0E-77
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4 569 2.0E-51
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1 845 2.0E-43
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1 848 3.0E-32
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 3 506 2.0E-31
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 3 506 2.0E-31
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 3 506 2.0E-31
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 3 506 2.0E-31
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 3 506 1.0E-30
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1 466 2.0E-30
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1 535 5.0E-30
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 3 512 6.0E-29
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1 848 9.0E-29
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1 504 1.0E-28
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1 848 2.0E-28
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1 505 2.0E-27
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 3 511 2.0E-27
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 3 511 3.0E-27
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 2 509 5.0E-27
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 4 848 6.0E-26
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1 407 2.0E-25
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 2 531 2.0E-25
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 514 3.0E-25
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 3 580 5.0E-25
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 3 559 1.0E-24
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 3 559 1.0E-24
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 3 559 1.0E-24
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1 848 3.0E-24
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1 423 1.0E-23
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 3 512 4.0E-23
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 7 467 6.0E-23
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 7 222 8.0E-23
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1 506 2.0E-22
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 7 514 2.0E-22
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1 423 2.0E-22
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 7 225 1.0E-21
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1 530 1.0E-21
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 7 225 3.0E-21
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 8 225 3.0E-21
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 5 359 4.0E-20
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1 506 9.0E-20
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 3 292 4.0E-19
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1 509 4.0E-19
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 3 266 5.0E-19
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1 511 9.0E-19
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 5 348 3.0E-18
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 3 289 3.0E-18
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1 509 7.0E-18
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 3 293 8.0E-18
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1 506 2.0E-17
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1 511 4.0E-17
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1 527 4.0E-17
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1 511 4.0E-17
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1 509 9.0E-17
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1 508 3.0E-16
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1 420 6.0E-16
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1 512 6.0E-16
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 3 289 1.0E-15
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 3 310 2.0E-15
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 3 289 5.0E-15
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 2 423 6.0E-15
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1 528 1.0E-14
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1 511 1.0E-14
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1 506 2.0E-14
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 9 248 7.0E-14
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 9 248 7.0E-14
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 9 248 8.0E-14
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 3 292 3.0E-13
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1 354 3.0E-13
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 3 292 1.0E-12
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 3 292 1.0E-12
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 3 292 1.0E-12
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1 223 6.0E-12
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 1 224 7.0E-12
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1 423 1.0E-11
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 6 289 8.0E-11
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 9 423 4.0E-10
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 1 224 4.0E-10
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 9 423 5.0E-10
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 9 423 5.0E-10
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 7 319 8.0E-10
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 24 277 2.0E-08
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 3 225 6.0E-08
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 333 600 3.0E-07
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 9 508 4.0E-07
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 9 508 4.0E-07
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 24 227 7.0E-07
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 17 226 7.0E-07
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 24 227 7.0E-07
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 24 227 7.0E-07
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 24 227 9.0E-07
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 24 227 9.0E-07
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 24 227 9.0E-07
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 24 227 1.0E-06
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 764 848 2.0E-06
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 3 146 2.0E-06
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 706 848 4.0E-06
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 24 277 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 18 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4898
MGHPLSTAVQIGLVDILKSWSIIPDLVLGHSSGEMAAAYASGAMSAEAAMAAAFFRSTTTPERNGSMAAIGIGRQ
EIGPYLKPGVVVACENSQCNVTISGDAEQVDKVILKVQQEQPEVVARHLRVKKAFHSHHMLQHGALYQETLEPYV
KSISPKIAFYSSVTGERLSGDGCLDPPYWRSNMESPVLFNTALRSALFSAKDGPYFFIEIGPHPALQGPVRQILR
DVGRSHDAYAGTLQRSKGCQVSLLDLGGKMFQQNASLDFSALCPAGRLVRNLPRYCWNQDTAYWAEPRIAHEWRF
RAHAPHHLLGTRAIELSNEPSWRNKLVLANVPWLAGHEVNGQIVFPAAGYISMIGEALGQLHGDLGYSLKHVKIA
AGLVLEHNKAVELVTTISKDSLLEYSSWYAFKISSYDGEKWIQHCAGQARPSFDKSVNLDAPEPIALARKVHDWY
KVLNRVGLNYTGRFRGLQNLSSATDKNVATATVPSQDMADGTKYAMHPAIIDQCLQVLIVAACRGLGRNCRTSAM
PTFIQEIVICPMEENEQSKDLRVTANTNNMNAGSFIGDVTAQNSGKVMLSLRGLKASPLTKDDTADKSLPVVSQL
EWRPHADFVDFEAYMHPQTEVPREWALLEELVILCILDHRENIELTDTTPVHLAKFYSWMKSHIENYESGLNKFL
SRHLELSQSTREKRLARIQEIVAHGEASQYPAYFTAIHRLFKTANSIFHGSTHPLHILIEDGLLSQIYDLSTKLD
VSELIQVISHTNPRLRILEVGAGTGGTTLNVLNALKSSQGERLYRSYVFTDISAGFNKAAKERFAQFDGIEYATL
DISRDPIEQGFQEGGYDLVIGSN*
Coding >OphauG2|4898
ATGGGGCATCCATTGTCCACTGCAGTACAGATTGGGCTGGTTGATATTCTTAAATCCTGGAGCATTATCCCAGAC
TTGGTGCTCGGGCACTCATCTGGTGAAATGGCCGCTGCATACGCCAGCGGGGCCATGAGTGCCGAAGCCGCCATG
GCAGCAGCCTTTTTCCGCAGTACAACGACACCCGAAAGGAATGGGTCCATGGCAGCTATTGGGATCGGGCGCCAA
GAGATTGGGCCATATTTGAAGCCTGGGGTTGTGGTTGCCTGTGAGAACAGCCAATGCAATGTCACCATCTCGGGA
GATGCAGAGCAGGTCGACAAGGTGATTTTAAAAGTCCAACAAGAGCAACCTGAAGTGGTTGCGCGTCATTTGCGC
GTCAAAAAGGCATTCCATTCCCATCATATGCTTCAACATGGTGCTCTGTACCAAGAAACCCTCGAGCCGTATGTA
AAGAGCATCTCTCCAAAGATAGCCTTTTATTCCTCTGTCACGGGGGAGAGGCTAAGTGGGGATGGATGCCTCGAT
CCGCCATACTGGCGAAGCAACATGGAGAGTCCGGTTCTCTTCAACACGGCTCTTCGGTCGGCACTCTTCTCTGCC
AAGGATGGGCCATATTTCTTCATCGAGATTGGACCTCACCCTGCGCTCCAAGGGCCAGTGCGACAGATTTTGAGA
GATGTTGGTCGAAGCCATGATGCTTACGCAGGCACCCTGCAGAGGAGTAAAGGCTGCCAGGTGAGTCTACTCGAC
CTCGGGGGCAAGATGTTTCAGCAGAATGCCAGTCTGGATTTCTCCGCCTTGTGTCCGGCGGGTCGTCTCGTTAGA
AATCTTCCACGATACTGCTGGAACCAAGACACGGCCTATTGGGCAGAACCGCGGATTGCGCACGAGTGGAGGTTC
CGTGCCCATGCACCGCACCATCTCCTCGGGACCAGAGCTATCGAGCTTTCCAACGAGCCAAGCTGGAGAAACAAG
CTTGTCCTGGCCAACGTGCCTTGGCTTGCCGGACACGAGGTCAATGGTCAAATAGTATTCCCAGCCGCAGGGTAT
ATATCCATGATAGGGGAGGCTCTTGGACAACTACATGGGGACCTTGGGTATAGTCTCAAGCATGTCAAGATTGCT
GCCGGGTTAGTGCTGGAGCACAACAAGGCGGTGGAACTCGTGACGACAATTTCAAAGGACTCTTTGCTGGAGTAT
TCATCCTGGTATGCATTCAAAATCAGCTCTTACGACGGAGAGAAATGGATCCAGCATTGTGCTGGCCAAGCACGA
CCATCATTTGACAAGTCGGTCAATCTCGACGCCCCCGAACCGATTGCACTTGCAAGAAAAGTCCATGATTGGTAC
AAGGTCCTGAACCGCGTGGGTCTCAACTATACCGGACGCTTTAGAGGATTGCAAAACTTGTCGTCTGCCACGGAC
AAAAACGTTGCCACGGCAACCGTTCCGTCCCAGGACATGGCAGATGGCACCAAATACGCGATGCACCCTGCCATT
ATCGATCAGTGCCTCCAGGTCCTCATAGTCGCCGCGTGCCGAGGACTGGGGAGAAACTGCCGCACCTCGGCGATG
CCAACCTTTATCCAGGAGATTGTGATTTGCCCCATGGAGGAAAACGAGCAGAGCAAGGACTTGCGTGTGACTGCA
AACACTAATAACATGAATGCAGGCTCCTTTATTGGCGACGTGACTGCGCAGAACAGCGGCAAGGTCATGTTATCC
CTCCGGGGTCTCAAGGCCTCTCCGCTCACCAAAGACGACACGGCAGACAAGAGCTTACCTGTTGTGAGCCAGCTC
GAGTGGAGGCCACATGCAGACTTTGTCGACTTTGAGGCCTACATGCATCCTCAAACAGAAGTCCCGAGGGAATGG
GCCCTGCTTGAGGAGCTCGTCATTCTTTGCATTCTTGACCACAGAGAAAACATTGAGCTGACAGACACGACGCCA
GTTCACCTTGCCAAGTTTTATTCTTGGATGAAGAGCCATATTGAGAATTACGAATCCGGGCTAAACAAGTTTTTG
TCGAGGCACCTCGAGCTGTCTCAGTCGACCAGAGAAAAGAGGCTGGCTAGGATCCAAGAGATTGTCGCTCATGGA
GAAGCCTCTCAATATCCTGCCTACTTTACGGCGATCCACCGCTTATTCAAGACGGCGAATAGCATATTCCATGGC
TCCACGCATCCGCTGCATATCCTCATTGAGGACGGCCTTCTTTCCCAGATTTACGACTTGTCAACCAAGTTGGAC
GTTTCCGAACTGATTCAAGTCATCTCTCACACAAATCCTAGGCTTAGGATTCTGGAAGTAGGCGCAGGCACCGGC
GGGACCACCTTGAATGTCCTGAATGCGCTCAAGTCGTCCCAGGGAGAACGGCTTTATCGGAGCTATGTATTCACC
GACATTTCTGCAGGCTTCAACAAAGCCGCCAAAGAACGCTTTGCCCAGTTTGATGGCATCGAGTACGCCACACTC
GACATATCCAGGGATCCTATTGAACAAGGATTCCAAGAGGGGGGTTATGATCTGGTTATTGGATCAAACTAA
Transcript >OphauG2|4898
ATGGGGCATCCATTGTCCACTGCAGTACAGATTGGGCTGGTTGATATTCTTAAATCCTGGAGCATTATCCCAGAC
TTGGTGCTCGGGCACTCATCTGGTGAAATGGCCGCTGCATACGCCAGCGGGGCCATGAGTGCCGAAGCCGCCATG
GCAGCAGCCTTTTTCCGCAGTACAACGACACCCGAAAGGAATGGGTCCATGGCAGCTATTGGGATCGGGCGCCAA
GAGATTGGGCCATATTTGAAGCCTGGGGTTGTGGTTGCCTGTGAGAACAGCCAATGCAATGTCACCATCTCGGGA
GATGCAGAGCAGGTCGACAAGGTGATTTTAAAAGTCCAACAAGAGCAACCTGAAGTGGTTGCGCGTCATTTGCGC
GTCAAAAAGGCATTCCATTCCCATCATATGCTTCAACATGGTGCTCTGTACCAAGAAACCCTCGAGCCGTATGTA
AAGAGCATCTCTCCAAAGATAGCCTTTTATTCCTCTGTCACGGGGGAGAGGCTAAGTGGGGATGGATGCCTCGAT
CCGCCATACTGGCGAAGCAACATGGAGAGTCCGGTTCTCTTCAACACGGCTCTTCGGTCGGCACTCTTCTCTGCC
AAGGATGGGCCATATTTCTTCATCGAGATTGGACCTCACCCTGCGCTCCAAGGGCCAGTGCGACAGATTTTGAGA
GATGTTGGTCGAAGCCATGATGCTTACGCAGGCACCCTGCAGAGGAGTAAAGGCTGCCAGGTGAGTCTACTCGAC
CTCGGGGGCAAGATGTTTCAGCAGAATGCCAGTCTGGATTTCTCCGCCTTGTGTCCGGCGGGTCGTCTCGTTAGA
AATCTTCCACGATACTGCTGGAACCAAGACACGGCCTATTGGGCAGAACCGCGGATTGCGCACGAGTGGAGGTTC
CGTGCCCATGCACCGCACCATCTCCTCGGGACCAGAGCTATCGAGCTTTCCAACGAGCCAAGCTGGAGAAACAAG
CTTGTCCTGGCCAACGTGCCTTGGCTTGCCGGACACGAGGTCAATGGTCAAATAGTATTCCCAGCCGCAGGGTAT
ATATCCATGATAGGGGAGGCTCTTGGACAACTACATGGGGACCTTGGGTATAGTCTCAAGCATGTCAAGATTGCT
GCCGGGTTAGTGCTGGAGCACAACAAGGCGGTGGAACTCGTGACGACAATTTCAAAGGACTCTTTGCTGGAGTAT
TCATCCTGGTATGCATTCAAAATCAGCTCTTACGACGGAGAGAAATGGATCCAGCATTGTGCTGGCCAAGCACGA
CCATCATTTGACAAGTCGGTCAATCTCGACGCCCCCGAACCGATTGCACTTGCAAGAAAAGTCCATGATTGGTAC
AAGGTCCTGAACCGCGTGGGTCTCAACTATACCGGACGCTTTAGAGGATTGCAAAACTTGTCGTCTGCCACGGAC
AAAAACGTTGCCACGGCAACCGTTCCGTCCCAGGACATGGCAGATGGCACCAAATACGCGATGCACCCTGCCATT
ATCGATCAGTGCCTCCAGGTCCTCATAGTCGCCGCGTGCCGAGGACTGGGGAGAAACTGCCGCACCTCGGCGATG
CCAACCTTTATCCAGGAGATTGTGATTTGCCCCATGGAGGAAAACGAGCAGAGCAAGGACTTGCGTGTGACTGCA
AACACTAATAACATGAATGCAGGCTCCTTTATTGGCGACGTGACTGCGCAGAACAGCGGCAAGGTCATGTTATCC
CTCCGGGGTCTCAAGGCCTCTCCGCTCACCAAAGACGACACGGCAGACAAGAGCTTACCTGTTGTGAGCCAGCTC
GAGTGGAGGCCACATGCAGACTTTGTCGACTTTGAGGCCTACATGCATCCTCAAACAGAAGTCCCGAGGGAATGG
GCCCTGCTTGAGGAGCTCGTCATTCTTTGCATTCTTGACCACAGAGAAAACATTGAGCTGACAGACACGACGCCA
GTTCACCTTGCCAAGTTTTATTCTTGGATGAAGAGCCATATTGAGAATTACGAATCCGGGCTAAACAAGTTTTTG
TCGAGGCACCTCGAGCTGTCTCAGTCGACCAGAGAAAAGAGGCTGGCTAGGATCCAAGAGATTGTCGCTCATGGA
GAAGCCTCTCAATATCCTGCCTACTTTACGGCGATCCACCGCTTATTCAAGACGGCGAATAGCATATTCCATGGC
TCCACGCATCCGCTGCATATCCTCATTGAGGACGGCCTTCTTTCCCAGATTTACGACTTGTCAACCAAGTTGGAC
GTTTCCGAACTGATTCAAGTCATCTCTCACACAAATCCTAGGCTTAGGATTCTGGAAGTAGGCGCAGGCACCGGC
GGGACCACCTTGAATGTCCTGAATGCGCTCAAGTCGTCCCAGGGAGAACGGCTTTATCGGAGCTATGTATTCACC
GACATTTCTGCAGGCTTCAACAAAGCCGCCAAAGAACGCTTTGCCCAGTTTGATGGCATCGAGTACGCCACACTC
GACATATCCAGGGATCCTATTGAACAAGGATTCCAAGAGGGGGGTTATGATCTGGTTATTGGATCAAACTAA
Gene >OphauG2|4898
ATGGGGCATCCATTGTCCACTGCAGTACAGATTGGGCTGGTTGATATTCTTAAATCCTGGAGCATTATCCCAGAC
TTGGTGCTCGGGCACTCATCTGGTGAAATGGCCGCTGCATACGCCAGCGGGGCCATGAGTGCCGAAGCCGCCATG
GCAGCAGCCTTTTTCCGCAGTACAACGACACCCGAAAGGAATGGGTCCATGGCAGCTATTGGGATCGGGCGCCAA
GAGATTGGGCCATATTTGAAGCCTGGGGTTGTGGTTGCCTGTGAGAACAGCCAATGCAATGTCACCATCTCGGGA
GATGCAGAGCAGGTCGACAAGGTGATTTTAAAAGTCCAACAAGAGCAACCTGAAGTGGTTGCGCGTCATTTGCGC
GTCAAAAAGGCATTCCATTCCCGTAAGTGGCCTCTTCGTATTCGGCACCAGGACAAGCAAGCATTGCTGAAGCGT
TGACTGCAGATCATATGCTTCAACATGGTGCTCTGTACCAAGAAACCCTCGAGCCGTATGTAAAGAGCATCTCTC
CAAAGATAGCCTTTTATTCCTCTGTCACGGGGGAGAGGCTAAGTGGGGATGGATGCCTCGATCCGCCATACTGGC
GAAGCAACATGGAGAGTCCGGTTCTCTTCAACACGGCTCTTCGGTCGGCACTCTTCTCTGCCAAGGATGGGCCAT
ATTTCTTCATCGAGATTGGACCTCACCCTGCGCTCCAAGGGCCAGTGCGACAGATTTTGAGAGATGTTGGTCGAA
GCCATGATGCTTACGCAGGCACCCTGCAGAGGAGTAAAGGCTGCCAGGTGAGTCTACTCGACCTCGGGGGCAAGA
TGTTTCAGCAGAATGCCAGTCTGGATTTCTCCGCCTTGTGTCCGGCGGGTCGTCTCGTTAGAAATCTTCCACGAT
ACTGCTGGAACCAAGACACGGCCTATTGGGCAGAACCGCGGATTGCGCACGAGTGGAGGTTCCGTGCCCATGCAC
CGCACCATCTCCTCGGGACCAGAGCTATCGAGCTTTCCAACGAGCCAAGCTGGAGAAACAAGCTTGTCCTGGCCA
ACGTGCCTTGGCTTGCCGGACACGAGGTCAATGGTCAAATAGTATTCCCAGCCGCAGGGTATATATCCATGATAG
GGGAGGCTCTTGGACAACTACATGGGGACCTTGGGTATAGTCTCAAGCATGTCAAGATTGCTGCCGGGTTAGTGC
TGGAGCACAACAAGGCGGTGGAACTCGTGACGACAATTTCAAAGGACTCTTTGCTGGAGTATTCATCCTGGTATG
CATTCAAAATCAGCTCTTACGACGGAGAGAAATGGATCCAGCATTGTGCTGGCCAAGCACGACCATCATTTGACA
AGTCGGTCAATCTCGACGCCCCCGAACCGATTGCACTTGCAAGAAAAGTCCATGATTGGTACAAGGTCCTGAACC
GCGTGGGTCTCAACTATACCGGACGCTTTAGAGGATTGCAAAACTTGTCGTCTGCCACGGACAAAAACGTTGCCA
CGGCAACCGTTCCGTCCCAGGACATGGCAGATGGCACCAAATACGCGATGCACCCTGCCATTATCGATCAGTGCC
TCCAGGTCCTCATAGTCGCCGCGTGCCGAGGACTGGGGAGAAACTGCCGCACCTCGGCGATGCCAACCTTTATCC
AGGAGATTGTGATTTGCCCCATGGAGGAAAACGAGCAGAGCAAGGACTTGCGTGTGACTGCAAACACTAATAACA
TGAATGCAGGCTCCTTTATTGGCGACGTGACTGCGCAGAACAGCGGCAAGGTCATGTTATCCCTCCGGGGTCTCA
AGGCCTCTCCGCTCACCAAAGACGACACGGCAGACAAGAGCTTACCTGTTGTGAGCCAGCTCGAGTGGAGGCCAC
ATGCAGACTTTGTCGACTTTGAGGCCTACATGCATCCTCAAACAGAAGTCCCGAGGGAATGGGCCCTGCTTGAGG
AGCTCGTCATTCTTTGCATTCTTGACCACAGAGAAAACATTGAGCTGACAGACACGACGCCAGTTCACCTTGCCA
AGTTTTATTCTTGGATGAAGAGCCATATTGAGAATTACGAATCCGGGCTAAACAAGTTTTTGTCGAGGCACCTCG
AGCTGTCTCAGTCGACCAGAGAAAAGAGGCTGGCTAGGATCCAAGAGATTGTCGCTCATGGAGAAGCCTCTCAAT
ATCCTGCCTACTTTACGGCGATCCACCGCTTATTCAAGACGGCGAATAGCATATTCCATGGCTCCACGCATCCGC
TGCATATCCTCATTGAGGACGGCCTTCTTTCCCAGATTTACGACTTGTCAACCAAGTTGGACGTTTCCGAACTGA
TTCAAGTCATCTCTCACACAAATCCTAGGCTTAGGATTCTGGAAGTAGGCGCAGGCACCGGCGGGACCACCTTGA
ATGTCCTGAATGCGCTCAAGTCGTCCCAGGGAGAACGGCTTTATCGGAGCTATGTATTCACCGACATTTCTGCAG
GCTTCAACAAAGCCGCCAAAGAACGCTTTGCCCAGTTTGATGGCATCGAGTACGCCACACTCGACATATCCAGGG
ATCCTATTGAACAAGGATTCCAAGAGGGGGGTTATGATCTGGTTATTGGATCAAACGTAATGAAGGGTTTTTTTA
TCCCAGAATCTCTTACAGATGCTAAGAAGCAATTCCAGGTGGTCCACGCCACTCCAAGCTTGCAGAAAACCCTTG
GAAATCTGCGGCGCTTGCTCAGTCCCGGGGGTCGACTGTTTTTGCTAGAGGTGTGCCCTAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail