Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4897
Gene name
LocationContig_425:6711..10034
Strand-
Gene length (bp)3323
Transcript length (bp)3006
Coding sequence length (bp)3006
Protein length (aa) 1002

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 1.9E-23 595 686
PF08659 KR KR domain 1.4E-29 707 791
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.9E-16 435 571
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.1E-14 396 514
PF00106 adh_short short chain dehydrogenase 1.4E-07 598 775
PF00550 PP-binding Phosphopantetheine attachment site 1.1E-06 925 989
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 2.0E-06 277 354

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 989 9.0E-120
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 253 795 3.0E-72
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 253 795 3.0E-72
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 259 839 6.0E-65
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 255 795 4.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 989 9.0E-120
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 253 795 3.0E-72
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 253 795 3.0E-72
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 259 839 6.0E-65
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 255 795 4.0E-64
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 289 994 2.0E-61
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 289 994 8.0E-61
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 289 782 6.0E-59
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 248 789 1.0E-58
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 237 795 1.0E-58
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 237 795 2.0E-58
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 245 801 9.0E-58
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 245 801 1.0E-57
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 245 801 1.0E-57
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 245 801 1.0E-57
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 245 801 1.0E-57
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 288 795 4.0E-57
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 238 795 1.0E-55
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 358 795 7.0E-51
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 109 992 2.0E-46
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 221 981 1.0E-42
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 268 996 1.0E-41
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 106 978 4.0E-41
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1 830 7.0E-41
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 269 978 1.0E-40
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1 981 2.0E-39
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 278 978 2.0E-39
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 175 830 2.0E-39
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 269 980 2.0E-39
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 106 799 4.0E-39
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 268 981 1.0E-38
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 269 980 1.0E-37
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 268 981 2.0E-37
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 269 993 6.0E-37
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 119 830 2.0E-36
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 269 980 5.0E-36
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 216 839 1.0E-35
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 268 981 2.0E-35
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 269 980 2.0E-35
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 269 994 1.0E-34
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 120 839 1.0E-34
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 269 980 3.0E-34
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 175 985 6.0E-34
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 594 994 7.0E-34
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 278 981 6.0E-33
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 162 832 2.0E-32
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 269 829 3.0E-32
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 216 996 4.0E-32
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 92 981 7.0E-32
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 268 830 9.0E-32
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 268 830 5.0E-31
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 279 981 9.0E-30
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 279 981 2.0E-29
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 175 829 3.0E-29
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 162 844 5.0E-29
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 273 831 2.0E-28
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 278 561 1.0E-26
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 271 571 2.0E-26
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 278 571 3.0E-26
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 277 580 2.0E-25
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 277 580 5.0E-25
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 593 799 1.0E-23
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 593 799 3.0E-23
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 251 486 5.0E-23
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 258 486 5.0E-22
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 258 575 5.0E-22
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 613 997 5.0E-21
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 278 571 2.0E-20
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 278 571 4.0E-20
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 312 571 4.0E-20
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 278 571 3.0E-19
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 278 488 6.0E-19
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 278 488 1.0E-18
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 278 486 2.0E-18
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 272 575 4.0E-18
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 278 488 7.0E-18
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 278 571 8.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 594 859 3.0E-16
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 278 535 5.0E-16
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 272 573 1.0E-15
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 278 488 1.0E-15
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 595 838 4.0E-15
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 275 579 4.0E-15
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 592 783 9.0E-15
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 275 579 4.0E-14
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 273 573 4.0E-13
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 266 486 6.0E-13
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 253 486 2.0E-12
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 278 486 3.0E-12
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 267 571 4.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 521 791 5.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 611 960 8.0E-12
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 272 573 1.0E-11
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 255 572 2.0E-11
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 279 486 2.0E-11
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 610 831 3.0E-11
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 592 780 4.0E-11
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 611 789 6.0E-11
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 584 812 6.0E-11
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 584 812 6.0E-11
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 584 812 6.0E-11
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 584 777 7.0E-11
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 591 778 2.0E-10
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 267 573 5.0E-10
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 278 573 1.0E-09
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 267 576 2.0E-09
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 589 795 6.0E-09
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 589 795 6.0E-09
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 589 795 6.0E-09
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 262 412 6.0E-09
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 370 572 1.0E-08
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 370 572 4.0E-08
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 590 794 1.0E-07
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 590 794 1.0E-07
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 590 794 1.0E-07
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 370 572 2.0E-07
sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 370 572 3.0E-07
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 598 779 4.0E-07
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 571 778 4.0E-07
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 370 572 4.0E-07
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 278 573 7.0E-07
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 278 573 7.0E-07
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 278 419 9.0E-07
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 260 573 1.0E-06
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 267 573 2.0E-06
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 313 573 2.0E-06
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 278 573 2.0E-06
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 278 419 2.0E-06
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 278 573 6.0E-06
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 278 573 7.0E-06
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 278 573 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4897
MGFLSGWWLGDEDNRANEPYVSPERWSRELVAAGFKQPDAMVLDIIAPYQQCVTILASPDIKVRTPPRVSLLCWT
RNGPYVEEMQSKLNSLAIAVDICIFGQQLPNQDVLCLLDLERPTIHDLSQDSFQTLVGYLKVLETRMIWATRSAQ
VRCEDPRFAMTLGFTRTARTDLSAKLFTVEIDNSSSITAATQALADILLRVQMPELDADSMAPDWEYAVVNGKVL
VPRMHWQTVTDAFTQIEDYNNRPSTKSLTVTTPGLLETIGWREAEREKLGYGEVVVQTRAVGLNFKDVLIALGAL
DNSMEEMGLEGSGVITEIGPGVDKLVVGDRVLYASIGCFTTRKTVSETLCVKMDDCMTFEQGAAIPSVYLTVIVA
LVDKANLKQGQTVLIHSACGGVGLAAVQIANMVGAEIYCTVSTQKKASYLVKNHGIQPSHIFQSRDSSFLGDIMR
ATNNRGVDAVLNSLSGHLLDASWKCVAKFGTLIEIGKRDFRRRAKLAMEVFEDNRTFVGLDVSQLCQAQPEKAAE
VLKRCIGWMRSGKIKPASIAKVCEAEQIEEAFRFMQKGAHIGKMIVRMPQDMSSLKSVKDIACPSLRANGCYLLV
GGLGGLGRAIATWLVEYGARHLMFLSRSASANPEAGDFIDELSSQGCQVQLVAGNVAIMADVKRAVQAAAKPIAG
VVNLSMVLKVSLRLTLVLSSKTNLTRHVYSEQDISLKEMSFADWNVAVEPKVQGTWNLHKALSPDLDFFILSSSI
SGIVGQHGQANYAAGNTFLDAFVQYRHQKGLAASVIDIGSVGDVGYTSKNPDVLDKLRKLGAYILHENDLVEAIN
LAIQRSRPGKTAVLPHRAYWNPSQIILGLVTTAPLASLGTSIAWKKDVRMSIYHSIHCHGEAVTKASAERDVIDS
LLTHAQKQPSILKEEGTTTVIATAIMSALANILTENKGNIKVQDSPANAGLDSLVAMQMRIWIRDRFGVDMTVLT
MLQSSSFLNLGEHVQLALSKRFLSQG*
Coding >OphauG2|4897
ATGGGATTTCTTTCTGGCTGGTGGCTAGGTGATGAGGACAATCGGGCCAATGAACCGTACGTTTCCCCCGAGCGA
TGGTCTAGAGAGTTGGTCGCTGCTGGGTTCAAACAGCCAGATGCCATGGTACTGGACATTATTGCTCCGTATCAA
CAATGCGTGACAATTCTTGCATCTCCCGACATCAAGGTCAGGACGCCACCAAGAGTTAGCCTGCTGTGCTGGACT
CGCAACGGGCCGTATGTTGAGGAGATGCAAAGCAAACTCAACTCTCTAGCCATAGCAGTCGATATTTGCATCTTT
GGGCAGCAACTGCCCAACCAGGACGTCCTATGTCTCCTTGATCTTGAGAGGCCCACGATTCATGATTTGAGCCAA
GACTCCTTCCAGACTCTGGTTGGTTATCTGAAAGTCCTCGAGACAAGAATGATATGGGCGACAAGGTCGGCTCAG
GTTCGTTGTGAGGATCCAAGATTTGCCATGACTTTGGGCTTCACTCGAACAGCCCGGACCGATCTTTCCGCAAAG
CTCTTCACGGTTGAAATTGACAATAGCAGCAGCATCACAGCCGCAACCCAGGCGCTAGCAGACATTCTCCTCCGT
GTCCAAATGCCCGAGTTGGACGCCGATTCAATGGCCCCTGACTGGGAATACGCAGTCGTCAATGGCAAGGTGCTC
GTTCCTCGGATGCACTGGCAGACCGTTACAGATGCCTTTACGCAGATTGAGGACTACAACAACCGGCCCTCGACG
AAAAGCCTCACCGTTACTACCCCGGGCTTGCTAGAAACTATAGGGTGGCGCGAAGCAGAGCGAGAGAAGCTCGGT
TATGGCGAGGTCGTAGTGCAAACAAGAGCTGTTGGGCTCAATTTCAAGGATGTTCTCATTGCTCTTGGTGCTCTC
GACAATAGCATGGAGGAAATGGGCCTTGAAGGCAGCGGTGTAATTACCGAGATTGGCCCTGGTGTTGACAAACTT
GTAGTTGGCGACCGGGTTCTTTACGCCTCGATTGGATGCTTCACGACGCGAAAAACAGTGTCCGAAACGCTCTGT
GTCAAGATGGATGACTGCATGACGTTTGAGCAAGGCGCTGCCATACCTTCTGTTTATCTGACTGTCATTGTGGCA
CTTGTTGACAAGGCAAACTTGAAACAGGGCCAGACGGTCCTCATTCACTCTGCCTGTGGTGGCGTCGGCTTGGCG
GCCGTTCAAATTGCGAACATGGTCGGGGCCGAGATTTATTGTACCGTCAGCACCCAAAAAAAGGCCAGCTATCTG
GTGAAAAACCACGGCATTCAACCGTCGCACATTTTTCAATCGCGAGATTCATCCTTTCTTGGCGACATTATGCGA
GCAACGAATAACCGGGGTGTAGATGCTGTGCTTAATTCCTTGTCGGGCCATCTTCTTGACGCCTCTTGGAAATGT
GTGGCCAAGTTTGGCACCCTGATTGAGATTGGCAAACGAGACTTCCGACGACGTGCAAAGCTCGCCATGGAGGTC
TTTGAGGACAATAGGACCTTTGTTGGCCTCGATGTGTCGCAATTGTGTCAAGCTCAACCTGAAAAGGCTGCCGAA
GTCTTGAAGCGATGCATCGGCTGGATGCGTTCGGGGAAGATCAAGCCTGCTTCCATTGCCAAGGTATGTGAAGCT
GAGCAGATAGAGGAAGCATTCCGCTTCATGCAGAAGGGGGCCCATATCGGCAAGATGATTGTCCGCATGCCCCAA
GACATGTCATCTCTCAAGTCGGTCAAAGACATAGCTTGTCCCTCCCTACGAGCTAATGGCTGCTATCTCCTCGTC
GGTGGCCTAGGTGGCCTCGGCAGAGCCATTGCCACTTGGCTAGTCGAATACGGTGCTCGCCACTTGATGTTCCTG
TCGCGGTCTGCGAGTGCAAACCCGGAAGCTGGCGATTTTATCGATGAGCTCTCTTCGCAGGGATGCCAAGTTCAG
CTGGTGGCCGGCAATGTCGCCATCATGGCTGATGTAAAGAGAGCCGTTCAAGCCGCAGCCAAGCCAATTGCTGGA
GTTGTAAACTTGTCCATGGTGTTAAAGGTGAGTCTCCGACTGACTCTGGTACTCTCGTCCAAGACGAATCTAACT
CGGCATGTGTACTCGGAACAGGATATTTCACTCAAAGAAATGAGCTTTGCAGACTGGAATGTAGCCGTGGAACCC
AAGGTCCAGGGCACGTGGAACCTGCACAAGGCCCTTTCTCCAGACCTGGACTTTTTCATCCTAAGCTCTTCGATA
AGTGGAATCGTGGGTCAGCATGGCCAAGCCAACTATGCGGCGGGCAACACATTCCTCGACGCCTTTGTGCAGTAC
CGCCACCAGAAGGGTCTTGCTGCATCCGTCATCGATATTGGATCCGTCGGTGACGTGGGATACACGTCCAAGAAC
CCAGATGTCCTGGACAAGCTCCGAAAATTGGGCGCGTATATTCTTCACGAAAATGACCTTGTCGAAGCGATAAAC
CTAGCCATCCAGAGGTCACGCCCGGGGAAGACGGCAGTCCTACCGCACAGAGCTTACTGGAACCCAAGTCAGATC
ATTCTTGGCCTTGTGACAACCGCACCACTCGCCTCTCTCGGCACTTCTATTGCATGGAAAAAAGACGTTCGCATG
AGCATCTACCATAGCATCCACTGCCATGGCGAAGCCGTTACAAAGGCTTCAGCCGAGCGAGATGTTATTGATAGT
CTCTTGACTCATGCACAAAAACAGCCCTCCATCCTGAAGGAGGAGGGCACCACGACTGTCATTGCAACCGCAATC
ATGTCTGCCTTGGCCAACATTTTGACCGAGAATAAAGGCAACATCAAGGTCCAAGACTCGCCCGCGAATGCCGGG
CTCGACTCTCTGGTTGCAATGCAAATGCGCATTTGGATCAGAGACAGATTTGGTGTCGATATGACCGTCTTGACC
ATGCTCCAAAGCTCTTCCTTTTTGAACTTGGGAGAGCACGTCCAACTCGCGCTATCCAAGAGGTTTTTGTCGCAA
GGATAA
Transcript >OphauG2|4897
ATGGGATTTCTTTCTGGCTGGTGGCTAGGTGATGAGGACAATCGGGCCAATGAACCGTACGTTTCCCCCGAGCGA
TGGTCTAGAGAGTTGGTCGCTGCTGGGTTCAAACAGCCAGATGCCATGGTACTGGACATTATTGCTCCGTATCAA
CAATGCGTGACAATTCTTGCATCTCCCGACATCAAGGTCAGGACGCCACCAAGAGTTAGCCTGCTGTGCTGGACT
CGCAACGGGCCGTATGTTGAGGAGATGCAAAGCAAACTCAACTCTCTAGCCATAGCAGTCGATATTTGCATCTTT
GGGCAGCAACTGCCCAACCAGGACGTCCTATGTCTCCTTGATCTTGAGAGGCCCACGATTCATGATTTGAGCCAA
GACTCCTTCCAGACTCTGGTTGGTTATCTGAAAGTCCTCGAGACAAGAATGATATGGGCGACAAGGTCGGCTCAG
GTTCGTTGTGAGGATCCAAGATTTGCCATGACTTTGGGCTTCACTCGAACAGCCCGGACCGATCTTTCCGCAAAG
CTCTTCACGGTTGAAATTGACAATAGCAGCAGCATCACAGCCGCAACCCAGGCGCTAGCAGACATTCTCCTCCGT
GTCCAAATGCCCGAGTTGGACGCCGATTCAATGGCCCCTGACTGGGAATACGCAGTCGTCAATGGCAAGGTGCTC
GTTCCTCGGATGCACTGGCAGACCGTTACAGATGCCTTTACGCAGATTGAGGACTACAACAACCGGCCCTCGACG
AAAAGCCTCACCGTTACTACCCCGGGCTTGCTAGAAACTATAGGGTGGCGCGAAGCAGAGCGAGAGAAGCTCGGT
TATGGCGAGGTCGTAGTGCAAACAAGAGCTGTTGGGCTCAATTTCAAGGATGTTCTCATTGCTCTTGGTGCTCTC
GACAATAGCATGGAGGAAATGGGCCTTGAAGGCAGCGGTGTAATTACCGAGATTGGCCCTGGTGTTGACAAACTT
GTAGTTGGCGACCGGGTTCTTTACGCCTCGATTGGATGCTTCACGACGCGAAAAACAGTGTCCGAAACGCTCTGT
GTCAAGATGGATGACTGCATGACGTTTGAGCAAGGCGCTGCCATACCTTCTGTTTATCTGACTGTCATTGTGGCA
CTTGTTGACAAGGCAAACTTGAAACAGGGCCAGACGGTCCTCATTCACTCTGCCTGTGGTGGCGTCGGCTTGGCG
GCCGTTCAAATTGCGAACATGGTCGGGGCCGAGATTTATTGTACCGTCAGCACCCAAAAAAAGGCCAGCTATCTG
GTGAAAAACCACGGCATTCAACCGTCGCACATTTTTCAATCGCGAGATTCATCCTTTCTTGGCGACATTATGCGA
GCAACGAATAACCGGGGTGTAGATGCTGTGCTTAATTCCTTGTCGGGCCATCTTCTTGACGCCTCTTGGAAATGT
GTGGCCAAGTTTGGCACCCTGATTGAGATTGGCAAACGAGACTTCCGACGACGTGCAAAGCTCGCCATGGAGGTC
TTTGAGGACAATAGGACCTTTGTTGGCCTCGATGTGTCGCAATTGTGTCAAGCTCAACCTGAAAAGGCTGCCGAA
GTCTTGAAGCGATGCATCGGCTGGATGCGTTCGGGGAAGATCAAGCCTGCTTCCATTGCCAAGGTATGTGAAGCT
GAGCAGATAGAGGAAGCATTCCGCTTCATGCAGAAGGGGGCCCATATCGGCAAGATGATTGTCCGCATGCCCCAA
GACATGTCATCTCTCAAGTCGGTCAAAGACATAGCTTGTCCCTCCCTACGAGCTAATGGCTGCTATCTCCTCGTC
GGTGGCCTAGGTGGCCTCGGCAGAGCCATTGCCACTTGGCTAGTCGAATACGGTGCTCGCCACTTGATGTTCCTG
TCGCGGTCTGCGAGTGCAAACCCGGAAGCTGGCGATTTTATCGATGAGCTCTCTTCGCAGGGATGCCAAGTTCAG
CTGGTGGCCGGCAATGTCGCCATCATGGCTGATGTAAAGAGAGCCGTTCAAGCCGCAGCCAAGCCAATTGCTGGA
GTTGTAAACTTGTCCATGGTGTTAAAGGTGAGTCTCCGACTGACTCTGGTACTCTCGTCCAAGACGAATCTAACT
CGGCATGTGTACTCGGAACAGGATATTTCACTCAAAGAAATGAGCTTTGCAGACTGGAATGTAGCCGTGGAACCC
AAGGTCCAGGGCACGTGGAACCTGCACAAGGCCCTTTCTCCAGACCTGGACTTTTTCATCCTAAGCTCTTCGATA
AGTGGAATCGTGGGTCAGCATGGCCAAGCCAACTATGCGGCGGGCAACACATTCCTCGACGCCTTTGTGCAGTAC
CGCCACCAGAAGGGTCTTGCTGCATCCGTCATCGATATTGGATCCGTCGGTGACGTGGGATACACGTCCAAGAAC
CCAGATGTCCTGGACAAGCTCCGAAAATTGGGCGCGTATATTCTTCACGAAAATGACCTTGTCGAAGCGATAAAC
CTAGCCATCCAGAGGTCACGCCCGGGGAAGACGGCAGTCCTACCGCACAGAGCTTACTGGAACCCAAGTCAGATC
ATTCTTGGCCTTGTGACAACCGCACCACTCGCCTCTCTCGGCACTTCTATTGCATGGAAAAAAGACGTTCGCATG
AGCATCTACCATAGCATCCACTGCCATGGCGAAGCCGTTACAAAGGCTTCAGCCGAGCGAGATGTTATTGATAGT
CTCTTGACTCATGCACAAAAACAGCCCTCCATCCTGAAGGAGGAGGGCACCACGACTGTCATTGCAACCGCAATC
ATGTCTGCCTTGGCCAACATTTTGACCGAGAATAAAGGCAACATCAAGGTCCAAGACTCGCCCGCGAATGCCGGG
CTCGACTCTCTGGTTGCAATGCAAATGCGCATTTGGATCAGAGACAGATTTGGTGTCGATATGACCGTCTTGACC
ATGCTCCAAAGCTCTTCCTTTTTGAACTTGGGAGAGCACGTCCAACTCGCGCTATCCAAGAGGTTTTTGTCGCAA
GGATAA
Gene >OphauG2|4897
ATGGTAAGGCTTGGGCATGCTGTCCTTTCCGGCTTTATCCAAGAATACTCAAACTAATACAAGGCCACCGCGTCA
GGGATTTCTTTCTGGCTGGTGGCTAGGTGATGAGGACAATCGGGCCAATGAACCGTACGTTTCCCCCGAGCGATG
GTCTAGAGAGTTGGTCGCTGCTGGGTTCAAACAGCCAGATGCCATGGTACTGGACATTATTGCTCCGTATCAACA
ATGCGTGACAATTCTTGCATCTCCCGACATCAAGGTCAGGACGCCACCAAGAGTTAGCCTGCTGTGCTGGACTCG
CAACGGGCCGTATGTTGAGGAGATGCAAAGCAAACTCAACTCTCTAGCCATAGCAGTCGATATTTGCATCTTTGG
GCAGCAACTGCCCAACCAGGACGTCCTATGTCTCCTTGATCTTGAGAGGCCCACGATTCATGATTTGAGCCAAGA
CTCCTTCCAGACTCTGGTTGGTTATCTGAAAGTCCTCGAGACAAGAATGATATGGGCGACAAGGTCGGCTCAGGT
TCGTTGTGAGGATCCAAGATTTGCCATGACTTTGGGCTTCACTCGAACAGCCCGGACCGATCTTTCCGCAAAGCT
CTTCACGGTTGAAATTGACAATAGCAGCAGCATCACAGCCGCAACCCAGGCGCTAGCAGACATTCTCCTCCGTGT
CCAAATGCCCGAGTTGGACGCCGATTCAATGGCCCCTGACTGGGAATACGCAGTCGTCAATGGCAAGGTGCTCGT
TCCTCGGATGCACTGGCAGACCGTTACAGATGCCTTTACGCAGATTGAGGACTACAACAACCGGCCCTCGACGAA
AAGCCTCACCGTTACTACCCCGGGCTTGCTAGAAACTATAGGGTGGCGCGAAGCAGAGCGAGAGAAGCTCGGTTA
TGGCGAGGTCGTAGTGCAAACAAGAGCTGTTGGGCTCAATTTCAAGGTTTGTGTCTTGCAGCTTCTTTTTCGAAT
ATCAAGTAGGAGAGCTGACAGATGGCCATTAAAGGATGTTCTCATTGCTCTTGGTGCTCTCGACAATAGCATGGA
GGAAATGGGCCTTGAAGGCAGCGGTGTAATTACCGAGATTGGCCCTGGTGTTGACAAACTTGTAGTTGGCGACCG
GGTTCTTTACGCCTCGATTGGATGCTTCACGACGCGAAAAACAGTGTCCGAAACGCTCTGTGTCAAGATGGATGA
CTGCATGACGTTTGAGCAAGGCGCTGCCATACCTTCTGTTTATCTGACTGTCATTGTGGCACTTGTTGACAAGGC
AAACTTGAAACAGGGCCAGGTAAAGCTGATGACTATTATTGATGAGAAAGAAACTGCTGATGCTTCCTCAGACGG
TCCTCATTCACTCTGCCTGTGGTGGCGTCGGCTTGGCGGCCGTTCAAATTGCGAACATGGTCGGGGCCGAGGTAA
GCCTTGTATATCCAGGGTTTATGATGAAAAAGGGTTGAGTCTGATATTTCAATCAAAGATTTATTGTACCGTCAG
CACCCAAAAAAAGGCCAGCTATCTGGTGAAAAACCACGGCATTCAACCGTCGCACATTTTTCAATCGCGAGATTC
ATCCTTTCTTGGCGACATTATGCGAGCAACGAATAACCGGGGTGTAGATGCTGTGCTTAATTCCTTGTCGGGCCA
TCTTCTTGACGCCTCTTGGAAATGTGTGGCCAAGTTTGGCACCCTGATTGAGATTGGCAAACGAGACTTCCGACG
ACGTGCAAAGCTCGCCATGGAGGTCTTTGAGGACAATAGGACCTTTGTTGGCCTCGATGTGTCGCAATTGTGTCA
AGCTCAACCTGAAAAGGCTGCCGAGTGAGTGCTGTTGATCCCCCATTGTGACTTGGATCATTTTTTTCCATTTTC
TGAATCTATAATCAAGAGTCTTGAAGCGATGCATCGGCTGGATGCGTTCGGGGAAGATCAAGCCTGCTTCCATTG
CCAAGGTATGTGAAGCTGAGCAGATAGAGGAAGCATTCCGCTTCATGCAGAAGGGGGCCCATATCGGCAAGATGA
TTGTCCGCATGCCCCAAGACATGTCATCTCTCAAGTCGGTCAAAGACATAGCTTGTCCCTCCCTACGAGCTAATG
GCTGCTATCTCCTCGTCGGTGGCCTAGGTGGCCTCGGCAGAGCCATTGCCACTTGGCTAGTCGAATACGGTGCTC
GCCACTTGATGTTCCTGTCGCGGTCTGCGAGTGCAAACCCGGAAGCTGGCGATTTTATCGATGAGCTCTCTTCGC
AGGGATGCCAAGTTCAGCTGGTGGCCGGCAATGTCGCCATCATGGCTGATGTAAAGAGAGCCGTTCAAGCCGCAG
CCAAGCCAATTGCTGGAGTTGTAAACTTGTCCATGGTGTTAAAGGTGAGTCTCCGACTGACTCTGGTACTCTCGT
CCAAGACGAATCTAACTCGGCATGTGTACTCGGAACAGGATATTTCACTCAAAGAAATGAGCTTTGCAGACTGGA
ATGTAGCCGTGGAACCCAAGGTCCAGGGCACGTGGAACCTGCACAAGGCCCTTTCTCCAGACCTGGACTTTTTCA
TCCTAAGCTCTTCGATAAGTGGAATCGTGGGTCAGCATGGCCAAGCCAACTATGCGGCGGGCAACACATTCCTCG
ACGCCTTTGTGCAGTACCGCCACCAGAAGGGTCTTGCTGCATCCGTCATCGATATTGGATCCGTCGGTGACGTGG
GATACACGTCCAAGAACCCAGATGTCCTGGACAAGCTCCGAAAATTGGGCGCGTATATTCTTCACGAAAATGACC
TTGTCGAAGCGATAAACCTAGCCATCCAGAGGTCACGCCCGGGGAAGACGGCAGTCCTACCGCACAGAGCTTACT
GGAACCCAAGTCAGATCATTCTTGGCCTTGTGACAACCGCACCACTCGCCTCTCTCGGCACTTCTATTGCATGGA
AAAAAGACGTTCGCATGAGCATCTACCATAGCATCCACTGCCATGGCGAAGCCGTTACAAAGGCTTCAGCCGAGC
GAGATGTTATTGATAGTCTCTTGACTCATGCACAAAAACAGCCCTCCATCCTGAAGGAGGAGGGCACCACGACTG
TCATTGCAACCGCAATCATGTCTGCCTTGGCCAACATTTTGACCGAGAATAAAGGCAACATCAAGGTCCAAGACT
CGCCCGCGAATGCCGGGCTCGACTCTCTGGTTGCAATGCAAATGCGCATTTGGATCAGAGACAGATTTGGTGTCG
ATATGACCGTCTTGACCATGCTCCAAAGCTCTTCCTTTTTGAACTTGGGAGAGCACGTCCAACTCGCGCTATCCA
AGAGGTTTTTGTCGCAAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail