Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4885
Gene name
LocationContig_424:557..2061
Strand+
Gene length (bp)1504
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 7.1E-18 247 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 75 393 3.0E-42
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 75 393 1.0E-40
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 93 396 7.0E-26
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 93 384 1.0E-25
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 109 385 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 75 393 3.0E-42
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 75 393 1.0E-40
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 93 396 7.0E-26
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 93 384 1.0E-25
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 109 385 5.0E-18
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 109 385 4.0E-17
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 233 392 3.0E-15
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 113 385 9.0E-14
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 248 384 2.0E-13
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 173 385 3.0E-13
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 232 391 8.0E-13
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 248 385 1.0E-12
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 81 391 2.0E-12
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 81 390 1.0E-11
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 73 393 2.0E-11
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 248 397 5.0E-11
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 248 385 4.0E-10
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 207 384 5.0E-09
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 248 391 7.0E-09
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 246 396 8.0E-09
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 68 386 1.0E-08
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 248 397 3.0E-08
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 248 390 3.0E-08
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 248 391 3.0E-08
sp|D5AP78|CRTF_RHOCB Demethylspheroidene O-methyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtF PE=1 SV=1 224 410 5.0E-08
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 248 386 7.0E-08
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 224 395 1.0E-07
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 106 412 1.0E-07
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 248 391 2.0E-07
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 248 390 4.0E-07
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 202 383 7.0E-07
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 248 391 8.0E-07
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 248 391 9.0E-07
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 246 391 1.0E-06
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 248 395 1.0E-06
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 246 391 2.0E-06
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 248 351 2.0E-06
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 250 403 2.0E-06
sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 277 384 2.0E-06
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 248 391 2.0E-06
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 248 391 3.0E-06
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 248 380 3.0E-06
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 248 390 4.0E-06
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 234 392 4.0E-06
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 266 401 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4885
MTETLPVDGSIANTPANIEALPQLLKEISHGITHLTSHGQVDRHQLLAKCRAMTMAIQTPRETMVDHCIMLTSSI
AAIGFGIETGLWKLMANNGDRAQRVDDLAASLGVDRILLSRMMRHMGATGYITETGAEEYQPTPFSKSLSLPRIS
SGYGYIVATAQSIFNFGNFCRERAWKLPTSENDTCFQQTNKTDQGFLAWVHDNGYGPGFNEFLGGFYMGRIPWMA
SGYYPVKERLIQGADTRPDAAFLVDIGGNVGHNLADFKQHYPEVPGSLILQDLPVVIGQIEHLDPSIVRMPYDFH
TQQPVKGARAYFMRAIMHDWSDQVCLSILARVKVAMKPGYSRLLINEFVIPPTGAYWEATALDLQLLTLMSSSER
TQAQWVDLLEKRAGLKIIGIWNSGRMDSENLIECELVP*
Coding >OphauG2|4885
ATGACAGAGACACTTCCAGTCGACGGCTCCATTGCCAATACGCCAGCTAACATTGAGGCCCTTCCCCAACTACTC
AAAGAAATTAGTCACGGAATTACACATCTCACTAGCCATGGACAAGTTGATCGTCATCAGCTGCTCGCCAAATGT
CGTGCCATGACCATGGCTATACAGACACCCAGAGAGACCATGGTGGACCATTGTATAATGCTGACTTCCTCTATT
GCAGCCATTGGCTTCGGCATCGAAACTGGTCTCTGGAAACTCATGGCCAACAACGGCGACAGAGCCCAACGTGTC
GACGACTTGGCTGCCAGTCTAGGGGTCGACCGAATTCTCCTAAGCCGAATGATGCGTCACATGGGCGCCACGGGC
TACATCACCGAGACTGGTGCAGAAGAATATCAGCCAACCCCCTTTTCCAAGTCTCTGTCCTTGCCCCGCATATCG
AGTGGCTACGGGTATATTGTAGCTACTGCGCAGTCCATCTTCAACTTTGGCAACTTTTGCCGTGAGCGAGCGTGG
AAGCTCCCTACATCCGAAAATGACACATGCTTTCAACAGACTAATAAAACCGACCAAGGCTTCCTCGCGTGGGTT
CATGATAATGGATACGGCCCCGGATTCAATGAATTCTTGGGTGGATTCTACATGGGACGCATACCTTGGATGGCT
TCAGGTTACTATCCTGTAAAGGAGCGCTTGATCCAAGGAGCCGATACTCGGCCTGATGCAGCATTTCTCGTCGAT
ATCGGCGGCAACGTGGGCCATAATTTGGCAGATTTCAAGCAACACTACCCCGAGGTGCCGGGCAGCTTGATCCTC
CAGGATCTGCCAGTGGTCATCGGCCAGATAGAGCATCTAGACCCATCTATTGTTCGCATGCCTTATGATTTTCAC
ACCCAACAGCCTGTTAAAGGTGCTCGGGCCTATTTCATGCGCGCAATTATGCACGACTGGTCAGACCAAGTATGC
CTAAGCATCCTTGCTCGCGTCAAAGTGGCCATGAAGCCTGGGTACAGCAGGCTCCTAATCAATGAATTTGTGATT
CCGCCTACTGGAGCATACTGGGAGGCTACAGCGCTCGACTTGCAGCTTTTGACTCTCATGTCGTCGTCTGAGAGA
ACACAGGCTCAATGGGTTGACTTGCTGGAGAAAAGGGCAGGGCTTAAGATTATTGGCATCTGGAACAGTGGCCGC
ATGGATTCGGAGAATCTGATTGAGTGCGAGCTGGTCCCATGA
Transcript >OphauG2|4885
ATGACAGAGACACTTCCAGTCGACGGCTCCATTGCCAATACGCCAGCTAACATTGAGGCCCTTCCCCAACTACTC
AAAGAAATTAGTCACGGAATTACACATCTCACTAGCCATGGACAAGTTGATCGTCATCAGCTGCTCGCCAAATGT
CGTGCCATGACCATGGCTATACAGACACCCAGAGAGACCATGGTGGACCATTGTATAATGCTGACTTCCTCTATT
GCAGCCATTGGCTTCGGCATCGAAACTGGTCTCTGGAAACTCATGGCCAACAACGGCGACAGAGCCCAACGTGTC
GACGACTTGGCTGCCAGTCTAGGGGTCGACCGAATTCTCCTAAGCCGAATGATGCGTCACATGGGCGCCACGGGC
TACATCACCGAGACTGGTGCAGAAGAATATCAGCCAACCCCCTTTTCCAAGTCTCTGTCCTTGCCCCGCATATCG
AGTGGCTACGGGTATATTGTAGCTACTGCGCAGTCCATCTTCAACTTTGGCAACTTTTGCCGTGAGCGAGCGTGG
AAGCTCCCTACATCCGAAAATGACACATGCTTTCAACAGACTAATAAAACCGACCAAGGCTTCCTCGCGTGGGTT
CATGATAATGGATACGGCCCCGGATTCAATGAATTCTTGGGTGGATTCTACATGGGACGCATACCTTGGATGGCT
TCAGGTTACTATCCTGTAAAGGAGCGCTTGATCCAAGGAGCCGATACTCGGCCTGATGCAGCATTTCTCGTCGAT
ATCGGCGGCAACGTGGGCCATAATTTGGCAGATTTCAAGCAACACTACCCCGAGGTGCCGGGCAGCTTGATCCTC
CAGGATCTGCCAGTGGTCATCGGCCAGATAGAGCATCTAGACCCATCTATTGTTCGCATGCCTTATGATTTTCAC
ACCCAACAGCCTGTTAAAGGTGCTCGGGCCTATTTCATGCGCGCAATTATGCACGACTGGTCAGACCAAGTATGC
CTAAGCATCCTTGCTCGCGTCAAAGTGGCCATGAAGCCTGGGTACAGCAGGCTCCTAATCAATGAATTTGTGATT
CCGCCTACTGGAGCATACTGGGAGGCTACAGCGCTCGACTTGCAGCTTTTGACTCTCATGTCGTCGTCTGAGAGA
ACACAGGCTCAATGGGTTGACTTGCTGGAGAAAAGGGCAGGGCTTAAGATTATTGGCATCTGGAACAGTGGCCGC
ATGGATTCGGAGAATCTGATTGAGTGCGAGCTGGTCCCATGA
Gene >OphauG2|4885
ATGACAGAGACACTTCCAGTCGACGGCTCCATTGCCAATACGCCAGCTAACATTGAGGCCCTTCCCCAACTACTC
AAAGAAATTAGTCACGGAATTACACATCTCACTAGCCATGGACAAGTTGATCGTCATCAGCTGCTCGCCAAATGT
CGTGCCATGACCATGGCTATACAGACACCCAGAGAGACCATGGTGGACCATTGTATAATGCTGGTTAGCACAATG
GAAACGACACGTCATGGTCTCACATATTCAACTAATTGACTTGCCAGACTTCCTCTATTGCAGCCATTGGCTTCG
GCATCGAAACTGGTCTCTGGAAACTCATGGCCAACAACGGCGACAGAGCCCAACGTGTCGACGACTTGGCTGCCA
GTCTAGGGGTCGACCGAATTCTCCTAAGTAGGTCTGCACTATGCTTTTGACTCAACGTGATTCCTAATACGCTTT
ATTACTACAGGCCGAATGATGCGTCACATGGGCGCCACGGGCTACATCACCGAGACTGGTGCAGAAGAATATCAG
CCAACCCCCTTTTCCAAGTCTCTGTCCTTGCCCCGCATATCGAGTGGCTACGGGTAGTAAGCATGCGCTCCGTCC
TCTTGACTACTTGTGTTTACTTGTCGACTTGGTCACTTTTCCACCTGCTCACTTATTCATAGTATTGTAGCTACT
GCGCAGTCCATCTTCAACTTTGGCAACTTTTGCCGTGAGCGAGCGTGGAAGCTCCCTACATCCGAAAATGACACA
TGCTTTCAACAGACTAATAAAACCGACCAAGGCTTCCTCGCGTGGGTTCATGATAATGGATACGGCCCCGGATTC
AATGAATTCTTGGGTGGATTCTACATGGGACGCATACCTTGGATGGCTTCAGGTTACTATCCTGTAAAGGAGCGC
TTGATCCAAGGAGCCGATACTCGGCCTGATGCAGCATTTCTCGTCGATATCGGCGGCAACGTGGGCCATAATTTG
GCAGATTTCAAGCAACACTACCCCGAGGTGCCGGGCAGCTTGATCCTCCAGGATCTGCCAGTGGTCATCGGCCAG
ATAGAGCATCTAGACCCATCTATTGTTCGCATGCCTTATGATTTTCACACCCAACAGCCTGTTAAAGGTTACCAA
TGCTCAAAATCCCAGTAGTGTCCGTCTCTCAACATATGCTTACTTGACCTCTTTAGGTGCTCGGGCCTATTTCAT
GCGCGCAATTATGCACGACTGGTCAGACCAAGTATGCCTAAGCATCCTTGCTCGCGTCAAAGTGGCCATGAAGCC
TGGGTACAGCAGGCTCCTAATCAATGAATTTGTGATTCCGCCTACTGGAGCATACTGGGAGGCTACAGCGCTCGA
CTTGCAGCTTTTGACTCTCATGTCGTCGTCTGAGAGAACACAGGCTCAATGGGTTGACTTGCTGGAGAAAAGGGC
AGGGCTTAAGATTATTGGCATCTGGAACAGTGGCCGCATGGATTCGGAGAATCTGATTGAGTGCGAGCTGGTCCC
ATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail