Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4884
Gene name
LocationContig_423:15254..15932
Strand-
Gene length (bp)678
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02214 BTB_2 BTB/POZ domain 4.2E-08 24 113
PF00651 BTB BTB/POZ domain 9.0E-06 23 117

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A3KMV1|SHKB1_BOVIN SH3KBP1-binding protein 1 OS=Bos taurus GN=SHKBP1 PE=2 SV=1 14 113 2.0E-07

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0051260 protein homooligomerization Yes
GO:0003674 molecular_function No
GO:0016043 cellular component organization No
GO:0043933 protein-containing complex organization No
GO:0005488 binding No
GO:0051259 protein complex oligomerization No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0022607 cellular component assembly No
GO:0065003 protein-containing complex assembly No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4884
MANEFEISAMIVRVPANHPRSRTIKLQVGERFFTTERETLVFESSYFDAVLAEHRDGEEETIFVDADPHLFEHIL
GYLRHGHFPIFYHGATGHDIGRYQALLAEAQFFGIKKLEDWLHKEKYFEAVKTTMRCEVFPDSSAVREADGEWDS
RTTVQIFPSWFLRQVYRCPRGIAVHAGDATLCGKKCLRALNFTFPQCETQASVSMLRVVTRTYLVPYVEDVSTGA
*
Coding >OphauG2|4884
ATGGCAAACGAATTTGAAATTAGTGCCATGATCGTAAGAGTGCCTGCGAACCACCCAAGAAGCCGCACAATCAAG
CTCCAAGTGGGCGAGAGATTCTTCACCACAGAGCGCGAAACTCTAGTCTTTGAAAGCTCCTACTTTGACGCCGTG
CTCGCTGAGCATCGGGACGGGGAAGAAGAGACCATTTTTGTCGACGCGGACCCGCATCTCTTTGAACATATTCTG
GGCTACCTCCGCCACGGCCACTTTCCCATCTTTTACCACGGCGCCACGGGCCACGATATCGGCCGATACCAGGCA
CTCCTAGCCGAGGCGCAGTTTTTTGGAATCAAGAAACTGGAGGATTGGCTGCACAAGGAGAAGTACTTTGAAGCC
GTCAAGACGACGATGCGGTGTGAAGTCTTTCCAGACTCTAGTGCAGTGCGCGAGGCCGACGGGGAGTGGGATTCG
CGCACGACTGTGCAGATCTTTCCGTCGTGGTTTCTTCGACAGGTGTATCGCTGTCCGCGCGGCATCGCGGTCCAT
GCGGGAGATGCGACGCTCTGTGGGAAAAAATGTCTCAGGGCGCTCAACTTTACTTTCCCGCAGTGCGAGACCCAG
GCCTCGGTGTCGATGCTAAGGGTGGTGACGAGGACGTATCTGGTGCCGTATGTCGAAGACGTGTCGACGGGAGCC
TAG
Transcript >OphauG2|4884
ATGGCAAACGAATTTGAAATTAGTGCCATGATCGTAAGAGTGCCTGCGAACCACCCAAGAAGCCGCACAATCAAG
CTCCAAGTGGGCGAGAGATTCTTCACCACAGAGCGCGAAACTCTAGTCTTTGAAAGCTCCTACTTTGACGCCGTG
CTCGCTGAGCATCGGGACGGGGAAGAAGAGACCATTTTTGTCGACGCGGACCCGCATCTCTTTGAACATATTCTG
GGCTACCTCCGCCACGGCCACTTTCCCATCTTTTACCACGGCGCCACGGGCCACGATATCGGCCGATACCAGGCA
CTCCTAGCCGAGGCGCAGTTTTTTGGAATCAAGAAACTGGAGGATTGGCTGCACAAGGAGAAGTACTTTGAAGCC
GTCAAGACGACGATGCGGTGTGAAGTCTTTCCAGACTCTAGTGCAGTGCGCGAGGCCGACGGGGAGTGGGATTCG
CGCACGACTGTGCAGATCTTTCCGTCGTGGTTTCTTCGACAGGTGTATCGCTGTCCGCGCGGCATCGCGGTCCAT
GCGGGAGATGCGACGCTCTGTGGGAAAAAATGTCTCAGGGCGCTCAACTTTACTTTCCCGCAGTGCGAGACCCAG
GCCTCGGTGTCGATGCTAAGGGTGGTGACGAGGACGTATCTGGTGCCGTATGTCGAAGACGTGTCGACGGGAGCC
TAG
Gene >OphauG2|4884
ATGGCAAACGAATTTGAAATTAGTGCCATGATCGTAAGAGTGCCTGCGAACCACCCAAGAAGCCGCACAATCAAG
CTCCAAGTGGGCGAGAGATTCTTCACCACAGAGCGCGAAACTCTAGTCTTTGAAAGCTCCTACTTTGACGCCGTG
CTCGCTGAGCATCGGGACGGGGAAGAAGAGACCATTTTTGTCGACGCGGACCCGCATCTCTTTGAACATATTCTG
GGCTACCTCCGCCACGGCCACTTTCCCATCTTTTACCACGGCGCCACGGGCCACGATATCGGCCGATACCAGGCA
CTCCTAGCCGAGGCGCAGTTTTTTGGAATCAAGAAACTGGAGGATTGGCTGCACAAGGAGAAGTACTTTGAAGCC
GTCAAGACGACGATGCGGTGTGAAGTCTTTCCAGACTCTAGTGCAGTGCGCGAGGCCGACGGGGAGTGGGATTCG
CGCACGACTGTGCAGATCTTTCCGTCGTGGTTTCTTCGACAGGTGTATCGCTGTCCGCGCGGCATCGCGGTCCAT
GCGGGAGATGCGACGCTCTGTGGGAAAAAATGTCTCAGGGCGCTCAACTTTACTTTCCCGCAGTGCGAGACCCAG
GCCTCGGTGTCGATGCTAAGGGTGGTGACGAGGACGTATCTGGTGCCGTATGTCGAAGACGTGTCGACGGGAGCC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail