Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4882
Gene name
LocationContig_423:10391..11789
Strand+
Gene length (bp)1398
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.0E-11 8 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10193|SRP1_SCHPO Pre-mRNA-splicing factor srp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp1 PE=1 SV=3 7 86 5.0E-31
sp|C6Y4C0|YFMR_SCHPO Putative splicing factor C222.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.18 PE=2 SV=1 5 84 6.0E-17
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 7 103 7.0E-08
sp|G3V6S8|SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus GN=Srsf6 PE=1 SV=1 8 85 5.0E-07
sp|Q3TWW8|SRSF6_MOUSE Serine/arginine-rich splicing factor 6 OS=Mus musculus GN=Srsf6 PE=1 SV=1 8 85 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10193|SRP1_SCHPO Pre-mRNA-splicing factor srp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp1 PE=1 SV=3 7 86 5.0E-31
sp|C6Y4C0|YFMR_SCHPO Putative splicing factor C222.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.18 PE=2 SV=1 5 84 6.0E-17
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 7 103 7.0E-08
sp|G3V6S8|SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus GN=Srsf6 PE=1 SV=1 8 85 5.0E-07
sp|Q3TWW8|SRSF6_MOUSE Serine/arginine-rich splicing factor 6 OS=Mus musculus GN=Srsf6 PE=1 SV=1 8 85 5.0E-07
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 8 72 5.0E-07
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 7 165 6.0E-07
sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 8 85 7.0E-07
sp|Q8WXF0|SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens GN=SRSF12 PE=2 SV=1 6 83 1.0E-06
sp|Q3B7L6|SRSF6_BOVIN Serine/arginine-rich splicing factor 6 OS=Bos taurus GN=SRSF6 PE=2 SV=1 8 85 1.0E-06
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 7 150 1.0E-06
sp|O88453|SAFB1_RAT Scaffold attachment factor B1 OS=Rattus norvegicus GN=Safb PE=1 SV=2 2 160 1.0E-06
sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 7 71 2.0E-06
sp|Q8VE97|SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus GN=Srsf4 PE=2 SV=1 8 85 5.0E-06
sp|Q8VYA5|RSZ33_ARATH Serine/arginine-rich splicing factor RS2Z33 OS=Arabidopsis thaliana GN=RS2Z33 PE=1 SV=1 4 94 6.0E-06
sp|Q08170|SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens GN=SRSF4 PE=1 SV=2 8 85 6.0E-06
sp|P0C196|PPIL4_USTMA Peptidyl-prolyl cis-trans isomerase-like 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP6 PE=3 SV=1 7 71 6.0E-06
sp|P92964|SRS31_ARATH Serine/arginine-rich splicing factor RS31 OS=Arabidopsis thaliana GN=RS31 PE=1 SV=2 8 83 7.0E-06
sp|P0CP88|PPIL4_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP6 PE=3 SV=1 7 71 8.0E-06
sp|P0CP89|PPIL4_CRYNB Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP6 PE=3 SV=1 7 71 8.0E-06
sp|Q9FYB7|RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana GN=RS2Z32 PE=1 SV=1 4 104 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4882
MSRGGTTLYVTGFSHGTRARDLAYEFERYGRLVRCDIPAPRSSSSRLFAFVEYEDRRDADDAYYEMHNKRIGRDD
MLKIEWARTPPSASWRFESGRDRDRRGGPRSPRRGRSPSPRRSGRDHSPRKDDRRDRDRDYDRDGRRDRDRSRSP
DPRDRDRDGKDDRDDRDRRENGANGDDRKGEALDSPPPVHDDLDVAE*
Coding >OphauG2|4882
ATGTCTCGTGGCGGCACAACGCTTTACGTGACCGGCTTTAGCCACGGCACCCGCGCTCGAGATCTCGCCTACGAG
TTCGAACGTTATGGGCGCCTTGTCCGTTGTGACATTCCGGCCCCGCGCTCCTCCTCGAGCCGACTCTTCGCCTTT
GTCGAGTACGAGGATCGTCGCGATGCCGATGATGCCTACTACGAGATGCACAACAAGCGCATCGGTCGTGATGAC
ATGCTGAAGATTGAGTGGGCGCGTACTCCTCCTTCGGCGTCGTGGCGCTTCGAGTCTGGCCGTGATCGTGACCGC
CGTGGTGGGCCCCGCTCACCTCGCCGTGGCCGATCACCTTCGCCTCGTCGTAGTGGACGTGATCACTCGCCGCGT
AAGGATGACCGACGGGATCGCGATCGCGACTATGACCGAGATGGCCGTCGTGATCGTGACCGTTCCCGCAGCCCT
GACCCTCGTGATCGTGACCGAGACGGCAAGGATGACCGCGATGATCGAGACCGACGCGAGAATGGCGCCAACGGC
GACGACCGCAAGGGTGAAGCTCTCGACAGCCCTCCCCCGGTTCACGACGATCTTGATGTCGCCGAATAG
Transcript >OphauG2|4882
ATGTCTCGTGGCGGCACAACGCTTTACGTGACCGGCTTTAGCCACGGCACCCGCGCTCGAGATCTCGCCTACGAG
TTCGAACGTTATGGGCGCCTTGTCCGTTGTGACATTCCGGCCCCGCGCTCCTCCTCGAGCCGACTCTTCGCCTTT
GTCGAGTACGAGGATCGTCGCGATGCCGATGATGCCTACTACGAGATGCACAACAAGCGCATCGGTCGTGATGAC
ATGCTGAAGATTGAGTGGGCGCGTACTCCTCCTTCGGCGTCGTGGCGCTTCGAGTCTGGCCGTGATCGTGACCGC
CGTGGTGGGCCCCGCTCACCTCGCCGTGGCCGATCACCTTCGCCTCGTCGTAGTGGACGTGATCACTCGCCGCGT
AAGGATGACCGACGGGATCGCGATCGCGACTATGACCGAGATGGCCGTCGTGATCGTGACCGTTCCCGCAGCCCT
GACCCTCGTGATCGTGACCGAGACGGCAAGGATGACCGCGATGATCGAGACCGACGCGAGAATGGCGCCAACGGC
GACGACCGCAAGGGTGAAGCTCTCGACAGCCCTCCCCCGGTTCACGACGATCTTGATGTCGCCGAATAG
Gene >OphauG2|4882
ATGTCTCGTGGCGGCACAACGCTTTACGTGACCGGCTTTAGCCACGGCACCCGCGCTCGAGATCTCGCCTACGAG
TTCGAACGGTATGTCAACTGCGCCTGCGCTGGCGTCTTTCGTTCAACGCCCTCGTCCTCGCCCTCGTCCACGTCG
CCCTCCGTCCTCTTCGCCCCCGACGACGAGAAAGCCTGTCCCCGCATCTCGATGCTCAAGACTTGATGCCAGGTC
TTGGGCACTCCAGCCTCGTCGTCGTCGTCGTCGCCCTCGTCGTCGCCCTCGCCCTCGTCCGCCCTCGTCATCCCT
CTCGCTCTGAGCCTGCCTTTATCAATTCCTCCTCCCATGTCCTGTCTCGCCGATGGATGCGCTTGCTGGCCCTTT
TCATGGTGGCGACTCTCAAGAGTCAGTCCTGAGCTTGCACAGTCTGTACTCGTGCGCCCAGCTTCATTATGGAGT
CATGGCTCTCGCGCCCCTCCGCCTTGCGGCTCTTACTCTTGCCTATCCCGCATCTGCTGCTCTCTTCCAAGATGC
CCGTGCCATCCACCTTTTCATCTCACCCTTCGCTCTTGATGCATGTGCCTTGAACAGGTCTTTCCAACGTACTAA
TCACTCTTGACCTTGTAGTTATGGGCGCCTTGTCCGTTGTGACATTCCGGCCCCGCGCTCCTCCTCGAGCCGACT
GTGAGTTTTTGTCTTGTTGTTGTGTCTTTTTCTCCACCAAAAGAGGTCAACTCTTGCTGACAGCCCTAACCCACC
ATGCCGCGCAGCTTCGCCTTTGTCGAGTACGAGGATCGTCGCGATGCCGATGATGCCTACTACGAGATGCACAAC
AAGCGCATCGGTCGTGATGACATGCTGAAGATTGAGGTTAGCAGACATGATTGCCACGTCACTTGCTCTTTTCTG
TTTCTGACTTGGCCATGCGGCAGTGGGCGCGTACTCCTCCTTCGGCGTCGTGGCGCTTCGAGTCTGGCCGTGATC
GTGACCGCCGTGGTGGGCCCCGCTCACCTCGCCGTGGCCGATCACCTTCGCCTCGTCGTAGTGGACGTGATCACT
CGCCGCGTAAGGATGACCGACGGGATCGCGATCGCGACTATGACCGAGATGGCCGTCGTGATCGTGACCGTTCCC
GCAGCCCTGACCCTCGGTTAGTTGGGCTACTTTGCGACTTTTGATTGGCAACACGGCATTGACAGGAGCTGTAGT
GATCGTGACCGAGACGGCAAGGATGACCGCGATGATCGAGACCGACGCGAGAATGGCGCCAACGGCGACGACCGC
AAGGGTAAGGCGGCGGTCATCATCACGGTTTAATGCTGTAGCTATCTAACATTGCTGGATTCTACAGGTGAAGCT
CTCGACAGCCCTCCCCCGGTTCACGACGATCTTGATGTCGCCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail