Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4880
Gene name
LocationContig_423:3882..6128
Strand+
Gene length (bp)2246
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00307 CH Calponin homology (CH) domain 2.0E-16 140 257
PF00307 CH Calponin homology (CH) domain 2.5E-15 289 390
PF00307 CH Calponin homology (CH) domain 1.3E-17 414 520
PF00307 CH Calponin homology (CH) domain 1.4E-09 540 645

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59945|FIMB_SCHPO Fimbrin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fim1 PE=1 SV=1 1 643 0.0E+00
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 1 641 0.0E+00
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 12 640 8.0E-168
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 115 641 2.0E-146
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 108 641 3.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59945|FIMB_SCHPO Fimbrin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fim1 PE=1 SV=1 1 643 0.0E+00
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 1 641 0.0E+00
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 12 640 8.0E-168
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 115 641 2.0E-146
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 108 641 3.0E-144
sp|Q3V0K9|PLSI_MOUSE Plastin-1 OS=Mus musculus GN=Pls1 PE=1 SV=1 17 642 1.0E-142
sp|A6H742|PLSI_BOVIN Plastin-1 OS=Bos taurus GN=PLS1 PE=2 SV=1 17 642 9.0E-142
sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 12 642 3.0E-140
sp|A7E3Q8|PLST_BOVIN Plastin-3 OS=Bos taurus GN=PLS3 PE=2 SV=1 12 642 4.0E-140
sp|Q63598|PLST_RAT Plastin-3 OS=Rattus norvegicus GN=Pls3 PE=1 SV=2 12 642 4.0E-140
sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 12 642 1.0E-139
sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 12 642 2.0E-138
sp|O50064|FIMB2_ARATH Fimbrin-2 OS=Arabidopsis thaliana GN=FIM2 PE=2 SV=1 125 641 3.0E-138
sp|Q7G188|FIMB1_ARATH Fimbrin-1 OS=Arabidopsis thaliana GN=FIM1 PE=1 SV=2 107 641 6.0E-137
sp|Q9FJ70|FIMB3_ARATH Fimbrin-3 OS=Arabidopsis thaliana GN=FIM3 PE=3 SV=1 134 641 1.0E-135
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 17 642 2.0E-135
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 12 642 8.0E-135
sp|Q14651|PLSI_HUMAN Plastin-1 OS=Homo sapiens GN=PLS1 PE=1 SV=2 17 642 4.0E-132
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 17 642 1.0E-130
sp|P19179|PLSI_CHICK Plastin-1 OS=Gallus gallus GN=PLS1 PE=1 SV=1 24 642 2.0E-129
sp|P46939|UTRO_HUMAN Utrophin OS=Homo sapiens GN=UTRN PE=1 SV=2 408 518 2.0E-09
sp|Q8NF91|SYNE1_HUMAN Nesprin-1 OS=Homo sapiens GN=SYNE1 PE=1 SV=4 414 644 9.0E-09
sp|Q9VEN1|FLNA_DROME Filamin-A OS=Drosophila melanogaster GN=cher PE=1 SV=2 177 391 2.0E-08
sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3 412 647 1.0E-07
sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 404 647 1.0E-07
sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 404 647 1.0E-07
sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4 393 518 2.0E-07
sp|D3ZHV2|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1 393 518 2.0E-07
sp|Q9QXZ0|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2 393 518 2.0E-07
sp|Q9QWN8|SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus GN=Sptbn2 PE=1 SV=2 412 647 2.0E-07
sp|Q6ZWR6|SYNE1_MOUSE Nesprin-1 OS=Mus musculus GN=Syne1 PE=1 SV=2 414 518 3.0E-07
sp|P11533|DMD_CHICK Dystrophin OS=Gallus gallus GN=DMD PE=2 SV=1 405 626 5.0E-07
sp|Q03001|DYST_HUMAN Dystonin OS=Homo sapiens GN=DST PE=1 SV=4 408 647 7.0E-07
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 416 640 8.0E-07
sp|P11530|DMD_RAT Dystrophin OS=Rattus norvegicus GN=Dmd PE=1 SV=2 403 626 8.0E-07
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 416 647 8.0E-07
sp|Q91ZU6|DYST_MOUSE Dystonin OS=Mus musculus GN=Dst PE=1 SV=2 414 647 9.0E-07
sp|Q3V0K9|PLSI_MOUSE Plastin-1 OS=Mus musculus GN=Pls1 PE=1 SV=1 412 644 1.0E-06
sp|P19179|PLSI_CHICK Plastin-1 OS=Gallus gallus GN=PLS1 PE=1 SV=1 411 644 1.0E-06
sp|A6H742|PLSI_BOVIN Plastin-1 OS=Bos taurus GN=PLS1 PE=2 SV=1 411 644 2.0E-06
sp|P11531|DMD_MOUSE Dystrophin OS=Mus musculus GN=Dmd PE=1 SV=3 403 626 2.0E-06
sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus GN=Plec PE=1 SV=3 416 640 3.0E-06
sp|Q9H254|SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2 412 647 3.0E-06
sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1 SV=1 408 518 4.0E-06
sp|P11532|DMD_HUMAN Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3 403 625 6.0E-06
sp|O97592|DMD_CANLF Dystrophin OS=Canis lupus familiaris GN=DMD PE=2 SV=1 403 518 6.0E-06
sp|Q8VHX6|FLNC_MOUSE Filamin-C OS=Mus musculus GN=Flnc PE=1 SV=3 140 375 7.0E-06
sp|D3ZHA0|FLNC_RAT Filamin-C OS=Rattus norvegicus GN=Flnc PE=1 SV=1 140 375 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4880
MNVLKLQKKFPQFQQNEIFSLSDAFKRLDVDDKGYIDEATAIKSTQQSESQPYDVVRQALKEVELDSSRRVELED
YVGLIAQVRHASPAQKRLSTGPLSPSSGGIVSQRTGGHSSKGSVGGKIQVQGSSANITHTINEDERTEFTRHINA
VLAGDADIGSRLPFPTDTFEMFDECKDGLVLAKLINDSVPDTIDERVMNRPGKKSKNLNAFQMTENNNIVIESCK
GIGCSVVNIGAGDIIEVREHLILGLIWQIIRRGLLGKIDIKLHPELYRLLEEDETLEQFLRLPPEQILLRWFNYH
LKAANWPRRVNNFSNDVKDGENYAVLMAQIGPEYGCTRKPLQTRDLLQRAEEVLQESDKLGCRKFLTPKSLVAGN
PKLNLAFVANLFNNHPALDPITEEEKLQVDDFDAEGEREARVFTLWLNSLDAQPPVVSFFDDLRDGTILLQAYDK
VIRGSVNWRHVNKPPAHGGEMLRFKAVENTNYAIELGKQNGFSLVGIQGADITDGQRTLTLGLVWQLMRKDITLT
LSSLAQKLGKREITDAEMVRWANDMSRKGGRSSSIRSFKDPSIGSGVFLLDVLSGIKSSYVDYALVTPGKTDEDA
YMNAKLSISIARKLGATIWLVPEDICQVRSRLVTTFIGSLMATYEKM*
Coding >OphauG2|4880
ATGAACGTCCTCAAGTTACAGAAGAAGTTTCCCCAGTTCCAGCAAAATGAAATCTTCTCCCTTTCCGACGCCTTT
AAGCGCCTCGATGTCGACGACAAGGGCTACATCGACGAGGCCACGGCTATAAAATCCACCCAGCAGAGCGAGAGC
CAGCCCTACGATGTCGTCCGTCAGGCCCTCAAAGAAGTCGAGCTCGACTCGTCACGGCGCGTCGAACTCGAGGAC
TATGTCGGCCTCATTGCCCAAGTCCGCCACGCCTCGCCCGCGCAAAAGCGCCTCTCTACCGGGCCACTGTCGCCC
AGCTCTGGAGGCATCGTCTCTCAACGCACCGGCGGCCATTCATCAAAGGGAAGCGTCGGCGGCAAGATTCAGGTC
CAGGGCTCCAGCGCAAACATTACCCACACCATCAACGAAGACGAGCGCACCGAGTTTACCCGCCACATCAATGCC
GTTCTCGCAGGCGATGCCGACATTGGCAGCCGTCTGCCCTTTCCCACCGATACCTTTGAGATGTTTGACGAATGC
AAGGACGGCTTGGTCTTGGCCAAGCTCATCAACGACAGCGTCCCGGATACCATTGACGAGCGCGTCATGAACCGC
CCGGGCAAGAAATCCAAAAATCTAAACGCCTTTCAAATGACGGAGAATAACAATATTGTCATTGAGTCGTGTAAA
GGTATTGGCTGCTCTGTTGTCAATATCGGTGCCGGCGACATCATTGAAGTCCGCGAGCATCTTATCCTCGGCCTT
ATTTGGCAAATCATTCGCCGCGGTCTCCTGGGCAAAATCGACATCAAGCTGCACCCTGAACTGTACAGGCTGCTG
GAAGAGGACGAGACGCTCGAGCAGTTTTTGCGACTACCGCCCGAACAGATTTTGCTTCGGTGGTTCAACTATCAT
CTCAAGGCCGCCAACTGGCCACGCAGAGTCAACAACTTTTCCAACGACGTCAAGGATGGCGAAAACTATGCCGTG
CTCATGGCGCAAATAGGCCCCGAGTACGGCTGCACACGCAAGCCCCTGCAGACAAGGGACCTGCTCCAGCGCGCT
GAAGAAGTGCTCCAAGAATCAGACAAGCTCGGGTGCCGCAAGTTCCTGACGCCAAAGTCCCTCGTCGCCGGCAAC
CCCAAGCTCAACCTGGCCTTTGTCGCCAACCTCTTCAACAACCACCCCGCCCTCGATCCCATTACCGAGGAGGAG
AAGCTCCAAGTCGACGACTTTGACGCCGAGGGCGAGCGCGAAGCCCGCGTCTTCACCCTGTGGCTCAACAGCCTC
GATGCCCAGCCCCCCGTAGTCTCCTTTTTTGACGACTTGCGCGACGGCACCATTCTCCTTCAGGCCTACGACAAG
GTCATCCGCGGCTCCGTTAACTGGCGCCACGTCAATAAGCCCCCCGCCCACGGCGGCGAAATGCTGCGCTTCAAG
GCCGTGGAAAATACAAACTATGCCATTGAGCTGGGCAAGCAAAACGGCTTCTCTCTTGTCGGCATCCAGGGCGCA
GACATTACCGACGGCCAGCGCACCCTGACTCTGGGCCTTGTCTGGCAGCTCATGCGCAAGGACATTACCCTGACG
CTCTCGTCGCTCGCCCAAAAGCTTGGTAAGCGCGAAATCACAGACGCCGAAATGGTGCGCTGGGCAAACGACATG
TCGCGCAAGGGCGGCCGCTCCTCGTCCATTCGCTCCTTCAAGGATCCGTCCATTGGCTCCGGCGTCTTCTTGCTC
GATGTCCTGAGCGGCATCAAGAGCAGCTACGTCGACTATGCCTTGGTTACGCCGGGCAAGACGGACGAGGATGCT
TACATGAATGCCAAGCTTAGCATCAGTATTGCGCGCAAGCTCGGCGCCACCATTTGGCTGGTGCCCGAGGATATC
TGCCAGGTGCGCAGCCGGCTCGTCACCACGTTTATCGGCTCGCTCATGGCCACTTATGAAAAGATGTAA
Transcript >OphauG2|4880
ATGAACGTCCTCAAGTTACAGAAGAAGTTTCCCCAGTTCCAGCAAAATGAAATCTTCTCCCTTTCCGACGCCTTT
AAGCGCCTCGATGTCGACGACAAGGGCTACATCGACGAGGCCACGGCTATAAAATCCACCCAGCAGAGCGAGAGC
CAGCCCTACGATGTCGTCCGTCAGGCCCTCAAAGAAGTCGAGCTCGACTCGTCACGGCGCGTCGAACTCGAGGAC
TATGTCGGCCTCATTGCCCAAGTCCGCCACGCCTCGCCCGCGCAAAAGCGCCTCTCTACCGGGCCACTGTCGCCC
AGCTCTGGAGGCATCGTCTCTCAACGCACCGGCGGCCATTCATCAAAGGGAAGCGTCGGCGGCAAGATTCAGGTC
CAGGGCTCCAGCGCAAACATTACCCACACCATCAACGAAGACGAGCGCACCGAGTTTACCCGCCACATCAATGCC
GTTCTCGCAGGCGATGCCGACATTGGCAGCCGTCTGCCCTTTCCCACCGATACCTTTGAGATGTTTGACGAATGC
AAGGACGGCTTGGTCTTGGCCAAGCTCATCAACGACAGCGTCCCGGATACCATTGACGAGCGCGTCATGAACCGC
CCGGGCAAGAAATCCAAAAATCTAAACGCCTTTCAAATGACGGAGAATAACAATATTGTCATTGAGTCGTGTAAA
GGTATTGGCTGCTCTGTTGTCAATATCGGTGCCGGCGACATCATTGAAGTCCGCGAGCATCTTATCCTCGGCCTT
ATTTGGCAAATCATTCGCCGCGGTCTCCTGGGCAAAATCGACATCAAGCTGCACCCTGAACTGTACAGGCTGCTG
GAAGAGGACGAGACGCTCGAGCAGTTTTTGCGACTACCGCCCGAACAGATTTTGCTTCGGTGGTTCAACTATCAT
CTCAAGGCCGCCAACTGGCCACGCAGAGTCAACAACTTTTCCAACGACGTCAAGGATGGCGAAAACTATGCCGTG
CTCATGGCGCAAATAGGCCCCGAGTACGGCTGCACACGCAAGCCCCTGCAGACAAGGGACCTGCTCCAGCGCGCT
GAAGAAGTGCTCCAAGAATCAGACAAGCTCGGGTGCCGCAAGTTCCTGACGCCAAAGTCCCTCGTCGCCGGCAAC
CCCAAGCTCAACCTGGCCTTTGTCGCCAACCTCTTCAACAACCACCCCGCCCTCGATCCCATTACCGAGGAGGAG
AAGCTCCAAGTCGACGACTTTGACGCCGAGGGCGAGCGCGAAGCCCGCGTCTTCACCCTGTGGCTCAACAGCCTC
GATGCCCAGCCCCCCGTAGTCTCCTTTTTTGACGACTTGCGCGACGGCACCATTCTCCTTCAGGCCTACGACAAG
GTCATCCGCGGCTCCGTTAACTGGCGCCACGTCAATAAGCCCCCCGCCCACGGCGGCGAAATGCTGCGCTTCAAG
GCCGTGGAAAATACAAACTATGCCATTGAGCTGGGCAAGCAAAACGGCTTCTCTCTTGTCGGCATCCAGGGCGCA
GACATTACCGACGGCCAGCGCACCCTGACTCTGGGCCTTGTCTGGCAGCTCATGCGCAAGGACATTACCCTGACG
CTCTCGTCGCTCGCCCAAAAGCTTGGTAAGCGCGAAATCACAGACGCCGAAATGGTGCGCTGGGCAAACGACATG
TCGCGCAAGGGCGGCCGCTCCTCGTCCATTCGCTCCTTCAAGGATCCGTCCATTGGCTCCGGCGTCTTCTTGCTC
GATGTCCTGAGCGGCATCAAGAGCAGCTACGTCGACTATGCCTTGGTTACGCCGGGCAAGACGGACGAGGATGCT
TACATGAATGCCAAGCTTAGCATCAGTATTGCGCGCAAGCTCGGCGCCACCATTTGGCTGGTGCCCGAGGATATC
TGCCAGGTGCGCAGCCGGCTCGTCACCACGTTTATCGGCTCGCTCATGGCCACTTATGAAAAGATGTAA
Gene >OphauG2|4880
ATGAACGTCCTCAAGTTACAGAAGTGCGCCGCCTTGTCCGTGGCCAGCCTGACCACCTTTTGTTTGCGCTGTTGC
GCTGCTGACGCGTCTCTAGGAAGTTTCCCCAGTTCCAGCAAAATGAAATCTTCTCCCTTTCCGACGCCTTTAAGC
GCCTCGATGTCGACGACAAGGGCTACATCGACGAGGCCACGGCTATAAAATCCACCCAGCAGAGCGAGAGCCAGC
CCTACGATGTCGTCCGTCAGGCCCTCAAAGAAGTCGAGCTCGACTCGTCACGGCGCGTCGAACTCGAGGACTATG
TCGGCGTGAGTCGCATAGCCCAAATCTTGAAGCAATCTTGAGCCCGCCTGCTGACTGCCCCCAGCTCATTGCCCA
AGTCCGCCACGCCTCGCCCGCGCAAAAGCGCCTCTCTACCGGGCCACTGTCGCCCAGCTCTGGAGGCATCGTCTC
TCAACGCACCGGCGGCCATTCATCAAAGGGAAGCGTCGGCGGCAAGATTCAGGTCCAGGGCTCCAGCGCAAACAT
TACCCACACCATCAACGAAGACGAGCGCACCGAGTTTACCCGCCACATCAATGCCGTTCTCGCAGGCGATGCCGA
CATTGGCAGCCGTCTGCCCTTTCCCACCGATACCTTTGAGATGTTTGACGAATGCAAGGACGGCTTGGTCTTGGC
CAAGCTCATCAACGACAGCGTCCCGGATACCATTGACGAGCGCGTCATGAACCGCCCGGGCAAGAAATCCAAAAA
TCTAAACGCCTTTCAAATGACGGAGAATAACAATATTGTCATTGAGTCGTGTAAAGGTATTGGCTGCTCTGTTGT
CAATATCGGTGCCGGCGACATCATTGAAGTCCGCGAGCATCTTATCCTCGGCCTTATTTGGCAAATCATTCGCCG
CGGTCTCCTGGGCAAAATCGACATCAAGCTGCACCCTGAACTGTACAGGCTGCTGGAAGAGGACGAGACGCTCGA
GCAGTTTTTGCGACTACCGCCCGAACAGATTTTGCTTCGGTGGTTCAACTATCATCTCAAGGCCGCCAACTGGCC
ACGCAGGCAAGTCTTTGCCACCAAATCTTCAAGGGTGACGCCCTTGTCTGACAAAGTCTTGATAGAGTCAACAAC
TTTTCCAACGACGTCAAGGATGGCGAAAACTATGCCGTGCTCATGGCGCAAATAGGCCCCGAGTACGGCTGCACA
CGCAAGCCCCTGCAGACAAGGGACCTGCTCCAGCGCGCTGAAGAAGTGCTCCAAGAATCAGACAAGCTCGGGTGC
CGCAAGTTCCTGACGCCAAAGTCCCTCGTCGCCGGCAACCCCAAGCTCAACCTGGCCTTTGTCGCCAACCTCTTC
AACAACCACCCCGCCCTCGATCCCATTACCGAGGAGGAGAAGCTCCAAGTCGACGACTTTGACGCCGAGGGCGAG
CGCGAAGCCCGCGTCTTCACCCTGTGGCTCAACAGCCTCGATGCCCAGCCCCCCGTAGTCTCCTTTTTTGACGAC
TTGCGCGACGGCACCATTCTCCTTCAGGCCTACGACAAGGTCATCCGCGGCTCCGTTAACTGGCGCCACGTCAAT
AAGCCCCCCGCCCACGGCGGCGAAATGCTGCGCTTCAAGGCCGTGGAAAATACAAACTATGCCATTGAGCTGGGC
AAGCAAAACGGCTTCTCTCTTGTCGGCATCCAGGGCGCAGACATTACCGACGGCCAGCGCACCCTGACTCTGGGC
CTTGTCTGGCAGCTCATGCGCAAGGACATTACCCTGACGCTCTCGTCGCTCGCCCAAAAGCTTGGTAAGCGCGAA
ATCACAGACGCCGAAATGGTGCGCTGGGCAAACGACATGTCGCGCAAGGGCGGCCGCTCCTCGTCCATTCGCTCC
TTCAAGGATCCGTCCATTGGCTCCGGCGTCTTCTTGCTCGATGTCCTGAGCGGCATCAAGAGCAGCTACGTCGAC
TATGCCTTGGTTACGCCGGGCAAGACGGACGAGGATGCTTACATGAATGCCAAGCTTAGCATCAGTATTGCGCGC
AAGCTCGGCGCCACCATTTGGCTGGTGCCCGAGGATATCTGCCAGGTGCGCAGCCGGCTCGTCACCACGTTTATC
GGTAAGAAGCCCTCCTCCACCCCCCTTTTTTTTTCTAGTTGCACATGTTTGCCCCCTCACATGGCTTCTTGATTT
TCTGTGTGGTAAGACGTATTTGCTAACACGGCATGATAGGCTCGCTCATGGCCACTTATGAAAAGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail