Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4877
Gene name
LocationContig_422:11080..14541
Strand+
Gene length (bp)3461
Transcript length (bp)2991
Coding sequence length (bp)2991
Protein length (aa) 997

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10537 WAC_Acf1_DNA_bd ATP-utilising chromatin assembly and remodelling N-terminal 2.4E-37 23 123
PF15613 WSD Williams-Beuren syndrome DDT (WSD), D-TOX E motif 4.8E-16 773 897
PF02791 DDT DDT domain 3.5E-15 371 428
PF15612 WHIM1 WSTF, HB1, Itc1p, MBD9 motif 1 4.5E-07 575 608

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 1 406 8.0E-31
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 519 914 2.0E-16
sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL216W PE=1 SV=1 1 221 4.0E-09
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 1 139 5.0E-09
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 22 139 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 1 406 8.0E-31
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 519 914 2.0E-16
sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL216W PE=1 SV=1 1 221 4.0E-09
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 1 139 5.0E-09
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 22 139 2.0E-08
sp|A2BIL7|BAZ1B_DANRE Tyrosine-protein kinase BAZ1B OS=Danio rerio GN=baz1b PE=1 SV=2 21 132 4.0E-07
sp|Q54ST3|Y2237_DICDI DDT domain-containing protein DDB_G0282237 OS=Dictyostelium discoideum GN=DDB_G0282237 PE=3 SV=1 21 124 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
DDT

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4877
MVLFKRKPVQFLSASGINDEAQEVWHIPQTGEIFCEYEDYLARMDFYKQRRFTDQITGHSGLSFFEAYNSELSGG
REVEAAFPEPLKGPILRKVQFQTVSRLDNLVDMIYDEFKSDYYPGEEVTVNMDGGDKLHGLVREKTAFGPRALPD
GSLTQPTARYLVNIKDSNEETFLPAERICRDRGVFTKSMLRSFIKKTVTRESWNGAPWLVMHDYAGTYHIDSRIP
ASLRHDAKIQQRKQLQALKRASSYEANNANGHGPSAPQSGPVRLPELKPAPKSHKSKQAQAAKGLRWPLNMPANG
ANGSLPPQDQGAAARDPTPPPPPPPPKYPIEDLLLEPKEGSVRPRLKFMCRDAPVEGVPVDAAYRHIDMDTVGAL
LETWDTINVYCEIFKLDSFTFDDYMEALKVASQQVHVELFEEIHCAILKILVNSELDGGKVNIVLPELEKTSDDE
DGADATAGSVVATPDAEPEPKPTGRATRSSLAKLEAERLAAEAAAAEEQSIKAELEYKQRAEQMLQEYDWVEHLR
KRDFAHGGWQRIIVGLLHQISKRERQQEACESLLRKLVPSNGEPTQEAVRQTYWSLDFNSRVMVLQILCMLTMET
GAVRAYMDDCSETMTKYRKERIEWQRKRKQAIEELRQYNDERKTLVPDRATPESPAQNSRRDEDDKMTDADESLV
TKDDYAEGTPDENGKGQKKRRNRGQHQDKQRKRDESKGGGVDRDKKKEVKPPVRLPPQQMKQYSKLLKEIEKRES
LIKSCEEEIGILENDLREADCPRTRVLGKDRFWNRYYWFERNGMPYAGLPNSSTAYAEYANGCIWVQGPDNLERE
GFIEVPPMDQEDHITRFNMTIAERKAKEEDGTSVFNAKQWGYICDSEDVDRLIRWLDPRGLNEVKLRKELLAYRE
KISTHMACRKSYLADGDDQADKKEDTVAKRTSTRIRDKTPPEDPKYRCLQWHNSMALDDLGHLHAEQPPPPRARK
QTKKREAMADLGGRAPKTRRR*
Coding >OphauG2|4877
ATGGTTCTCTTCAAGCGCAAGCCAGTACAGTTTTTAAGTGCGTCTGGTATCAACGATGAAGCTCAAGAGGTTTGG
CACATTCCCCAGACGGGTGAAATCTTTTGCGAGTATGAAGATTATCTTGCTCGCATGGACTTTTACAAACAGCGC
CGTTTCACCGACCAGATCACGGGACACTCAGGCCTCTCATTCTTTGAAGCTTATAACAGCGAGCTTTCTGGAGGC
CGAGAGGTTGAGGCTGCATTTCCTGAGCCTCTCAAGGGCCCTATTCTTCGCAAGGTGCAGTTTCAGACAGTATCT
CGTCTCGATAATCTCGTGGACATGATTTATGATGAGTTCAAGAGCGACTACTACCCAGGGGAAGAAGTGACAGTC
AACATGGACGGGGGCGACAAATTACACGGGCTTGTCCGTGAAAAGACTGCCTTTGGCCCCCGTGCACTGCCCGAT
GGCTCATTGACACAGCCTACCGCTCGTTATCTAGTCAACATCAAGGACTCCAACGAGGAGACGTTTCTTCCTGCT
GAGCGCATCTGCCGCGACCGCGGCGTCTTCACCAAGTCGATGCTACGCTCCTTTATTAAGAAGACTGTTACGCGC
GAATCATGGAACGGAGCGCCATGGTTGGTGATGCATGATTATGCTGGAACATACCACATTGACTCTCGAATACCG
GCTTCGCTTCGTCACGATGCAAAGATCCAGCAGCGCAAGCAGCTCCAGGCCCTGAAGCGTGCTTCGTCATACGAA
GCCAACAATGCCAACGGACACGGCCCGAGTGCACCACAGTCGGGTCCCGTTCGCTTGCCCGAACTTAAGCCGGCC
CCCAAGAGCCACAAGAGCAAGCAGGCTCAGGCTGCCAAAGGTCTCCGGTGGCCATTAAACATGCCGGCCAACGGA
GCCAATGGAAGCCTGCCGCCCCAAGACCAGGGAGCTGCGGCTCGAGACCCGACGCCACCGCCCCCGCCACCGCCC
CCCAAGTACCCGATCGAGGACTTGCTTCTCGAGCCCAAGGAGGGCAGCGTACGGCCCCGGCTCAAGTTTATGTGC
AGAGATGCTCCGGTTGAGGGTGTGCCAGTGGATGCTGCGTATCGCCACATTGACATGGACACGGTCGGCGCGCTG
CTCGAGACGTGGGACACAATCAACGTCTACTGTGAGATCTTTAAGCTTGACTCGTTTACCTTTGACGACTACATG
GAGGCTTTGAAGGTGGCATCCCAACAGGTGCACGTTGAACTGTTTGAAGAGATACACTGTGCCATTCTGAAGATT
CTTGTCAACTCGGAACTTGATGGCGGCAAGGTCAATATCGTGCTTCCGGAGCTCGAAAAAACAAGCGACGACGAA
GATGGCGCAGATGCAACGGCGGGCAGCGTCGTGGCAACGCCTGATGCAGAACCGGAACCAAAGCCTACCGGACGG
GCCACTCGTAGCAGCCTCGCAAAACTCGAGGCCGAACGCCTAGCCGCCGAGGCGGCCGCTGCTGAAGAACAAAGC
ATCAAGGCGGAGCTTGAATACAAGCAGCGGGCTGAGCAAATGCTCCAAGAGTACGACTGGGTCGAGCATTTGCGC
AAGCGAGATTTTGCACATGGCGGCTGGCAGCGCATCATTGTTGGCTTGCTGCACCAAATCTCCAAGAGGGAGCGG
CAGCAAGAGGCCTGTGAGAGCCTTTTGCGAAAGCTGGTGCCAAGCAATGGAGAGCCTACACAAGAGGCGGTGCGA
CAGACGTACTGGAGTCTCGACTTCAACAGCCGCGTCATGGTACTTCAGATTCTCTGCATGCTTACCATGGAGACG
GGTGCTGTGCGGGCCTACATGGACGACTGCAGTGAGACAATGACCAAGTATCGAAAGGAGAGGATTGAATGGCAG
CGGAAGCGGAAGCAAGCGATTGAGGAACTGCGTCAGTATAATGACGAGCGCAAGACCTTGGTGCCTGACAGAGCA
ACGCCCGAGTCACCAGCTCAGAACTCTAGAAGAGACGAGGATGATAAGATGACTGACGCGGACGAGTCGCTTGTG
ACCAAGGACGATTACGCAGAAGGCACTCCGGACGAAAACGGCAAGGGGCAAAAAAAGCGCCGAAACCGTGGCCAA
CATCAAGACAAGCAGCGGAAGCGTGACGAGAGCAAGGGCGGCGGGGTGGATCGCGACAAGAAGAAGGAGGTTAAG
CCACCCGTCAGATTGCCACCGCAGCAAATGAAGCAGTACAGCAAGCTGCTCAAGGAAATTGAAAAGAGGGAAAGC
CTCATCAAGTCTTGTGAGGAGGAGATTGGGATTCTCGAAAATGACCTTCGCGAGGCCGACTGCCCACGTACCCGG
GTGCTTGGAAAGGATCGATTCTGGAACAGATACTACTGGTTTGAGCGCAACGGCATGCCATATGCAGGTCTGCCC
AACAGTTCGACTGCTTACGCCGAATACGCCAATGGGTGTATCTGGGTCCAGGGGCCGGATAATCTTGAGCGCGAG
GGCTTTATCGAGGTGCCCCCAATGGACCAAGAGGATCATATCACGCGCTTCAACATGACGATAGCTGAGCGCAAG
GCCAAGGAGGAGGACGGGACGAGCGTCTTCAACGCGAAGCAATGGGGCTACATTTGCGACAGCGAAGACGTTGAT
CGGCTGATTCGATGGCTCGATCCGCGCGGTCTCAACGAGGTCAAGCTGCGCAAGGAGTTACTGGCATATCGAGAA
AAGATTTCGACGCACATGGCCTGTCGCAAGTCGTACCTGGCAGATGGCGATGACCAGGCAGACAAGAAGGAGGAC
ACGGTGGCCAAGCGCACGAGTACTCGCATCCGGGACAAGACACCGCCAGAGGATCCCAAGTATAGGTGTCTGCAG
TGGCACAACTCGATGGCACTCGACGATCTCGGGCATTTACATGCTGAACAGCCTCCACCGCCACGGGCTCGCAAG
CAAACCAAGAAGCGTGAGGCCATGGCTGACCTTGGGGGACGGGCACCCAAGACGCGACGACGATGA
Transcript >OphauG2|4877
ATGGTTCTCTTCAAGCGCAAGCCAGTACAGTTTTTAAGTGCGTCTGGTATCAACGATGAAGCTCAAGAGGTTTGG
CACATTCCCCAGACGGGTGAAATCTTTTGCGAGTATGAAGATTATCTTGCTCGCATGGACTTTTACAAACAGCGC
CGTTTCACCGACCAGATCACGGGACACTCAGGCCTCTCATTCTTTGAAGCTTATAACAGCGAGCTTTCTGGAGGC
CGAGAGGTTGAGGCTGCATTTCCTGAGCCTCTCAAGGGCCCTATTCTTCGCAAGGTGCAGTTTCAGACAGTATCT
CGTCTCGATAATCTCGTGGACATGATTTATGATGAGTTCAAGAGCGACTACTACCCAGGGGAAGAAGTGACAGTC
AACATGGACGGGGGCGACAAATTACACGGGCTTGTCCGTGAAAAGACTGCCTTTGGCCCCCGTGCACTGCCCGAT
GGCTCATTGACACAGCCTACCGCTCGTTATCTAGTCAACATCAAGGACTCCAACGAGGAGACGTTTCTTCCTGCT
GAGCGCATCTGCCGCGACCGCGGCGTCTTCACCAAGTCGATGCTACGCTCCTTTATTAAGAAGACTGTTACGCGC
GAATCATGGAACGGAGCGCCATGGTTGGTGATGCATGATTATGCTGGAACATACCACATTGACTCTCGAATACCG
GCTTCGCTTCGTCACGATGCAAAGATCCAGCAGCGCAAGCAGCTCCAGGCCCTGAAGCGTGCTTCGTCATACGAA
GCCAACAATGCCAACGGACACGGCCCGAGTGCACCACAGTCGGGTCCCGTTCGCTTGCCCGAACTTAAGCCGGCC
CCCAAGAGCCACAAGAGCAAGCAGGCTCAGGCTGCCAAAGGTCTCCGGTGGCCATTAAACATGCCGGCCAACGGA
GCCAATGGAAGCCTGCCGCCCCAAGACCAGGGAGCTGCGGCTCGAGACCCGACGCCACCGCCCCCGCCACCGCCC
CCCAAGTACCCGATCGAGGACTTGCTTCTCGAGCCCAAGGAGGGCAGCGTACGGCCCCGGCTCAAGTTTATGTGC
AGAGATGCTCCGGTTGAGGGTGTGCCAGTGGATGCTGCGTATCGCCACATTGACATGGACACGGTCGGCGCGCTG
CTCGAGACGTGGGACACAATCAACGTCTACTGTGAGATCTTTAAGCTTGACTCGTTTACCTTTGACGACTACATG
GAGGCTTTGAAGGTGGCATCCCAACAGGTGCACGTTGAACTGTTTGAAGAGATACACTGTGCCATTCTGAAGATT
CTTGTCAACTCGGAACTTGATGGCGGCAAGGTCAATATCGTGCTTCCGGAGCTCGAAAAAACAAGCGACGACGAA
GATGGCGCAGATGCAACGGCGGGCAGCGTCGTGGCAACGCCTGATGCAGAACCGGAACCAAAGCCTACCGGACGG
GCCACTCGTAGCAGCCTCGCAAAACTCGAGGCCGAACGCCTAGCCGCCGAGGCGGCCGCTGCTGAAGAACAAAGC
ATCAAGGCGGAGCTTGAATACAAGCAGCGGGCTGAGCAAATGCTCCAAGAGTACGACTGGGTCGAGCATTTGCGC
AAGCGAGATTTTGCACATGGCGGCTGGCAGCGCATCATTGTTGGCTTGCTGCACCAAATCTCCAAGAGGGAGCGG
CAGCAAGAGGCCTGTGAGAGCCTTTTGCGAAAGCTGGTGCCAAGCAATGGAGAGCCTACACAAGAGGCGGTGCGA
CAGACGTACTGGAGTCTCGACTTCAACAGCCGCGTCATGGTACTTCAGATTCTCTGCATGCTTACCATGGAGACG
GGTGCTGTGCGGGCCTACATGGACGACTGCAGTGAGACAATGACCAAGTATCGAAAGGAGAGGATTGAATGGCAG
CGGAAGCGGAAGCAAGCGATTGAGGAACTGCGTCAGTATAATGACGAGCGCAAGACCTTGGTGCCTGACAGAGCA
ACGCCCGAGTCACCAGCTCAGAACTCTAGAAGAGACGAGGATGATAAGATGACTGACGCGGACGAGTCGCTTGTG
ACCAAGGACGATTACGCAGAAGGCACTCCGGACGAAAACGGCAAGGGGCAAAAAAAGCGCCGAAACCGTGGCCAA
CATCAAGACAAGCAGCGGAAGCGTGACGAGAGCAAGGGCGGCGGGGTGGATCGCGACAAGAAGAAGGAGGTTAAG
CCACCCGTCAGATTGCCACCGCAGCAAATGAAGCAGTACAGCAAGCTGCTCAAGGAAATTGAAAAGAGGGAAAGC
CTCATCAAGTCTTGTGAGGAGGAGATTGGGATTCTCGAAAATGACCTTCGCGAGGCCGACTGCCCACGTACCCGG
GTGCTTGGAAAGGATCGATTCTGGAACAGATACTACTGGTTTGAGCGCAACGGCATGCCATATGCAGGTCTGCCC
AACAGTTCGACTGCTTACGCCGAATACGCCAATGGGTGTATCTGGGTCCAGGGGCCGGATAATCTTGAGCGCGAG
GGCTTTATCGAGGTGCCCCCAATGGACCAAGAGGATCATATCACGCGCTTCAACATGACGATAGCTGAGCGCAAG
GCCAAGGAGGAGGACGGGACGAGCGTCTTCAACGCGAAGCAATGGGGCTACATTTGCGACAGCGAAGACGTTGAT
CGGCTGATTCGATGGCTCGATCCGCGCGGTCTCAACGAGGTCAAGCTGCGCAAGGAGTTACTGGCATATCGAGAA
AAGATTTCGACGCACATGGCCTGTCGCAAGTCGTACCTGGCAGATGGCGATGACCAGGCAGACAAGAAGGAGGAC
ACGGTGGCCAAGCGCACGAGTACTCGCATCCGGGACAAGACACCGCCAGAGGATCCCAAGTATAGGTGTCTGCAG
TGGCACAACTCGATGGCACTCGACGATCTCGGGCATTTACATGCTGAACAGCCTCCACCGCCACGGGCTCGCAAG
CAAACCAAGAAGCGTGAGGCCATGGCTGACCTTGGGGGACGGGCACCCAAGACGCGACGACGATGA
Gene >OphauG2|4877
ATGGTAAGCTCCGCCTTGGACTCTTTCACTCACTCATGGGCCCAGCCGTGCAAAGGAGCCAATGCCAATCTCATG
CGTCTTCATCCAGGTTCTCTTCAAGCGCAAGCCAGTACAGTTTTTAAGTGCGTCTGGTATCAACGATGAAGCTCA
AGAGGTAAAAACTCATTTCACTTCTTGTCCGCCGTGTGCCTCGCCTGGCTTTGCCGCTGACTCTGAGCCCGGCAG
GTTTGGCACATTCCCCAGACGGGTGAAATCTTTTGCGAGTATGAAGATTATCTTGCTCGGTAAGCCAATCTGTTT
GTCAGTGCACAACAAACTCAGGCTGACCTGGGTGACTCCAGCATGGACTTTTACAAACAGGTATAGCCAATGTCT
TGCTGCACCTCGGACGGCAGAGCTCCAGGCTAACCCAATTGTAGCGCCGTTTCACCGACCAGATCACGGGACACT
CAGGCCTCTCATTCTTTGAAGCTTATAACAGCGAGGTTGGTGGCCTTTTTCTCCCCCTTCTTCTTTGCCATGTAT
AGTGCTTGTTGCTTGCCTCGTCTTTGTTTGCTTACCAAGTCTGCTTGCCACGAAATGCAACTAACCAAGGCTCGC
CAAGCACAGCTTTCTGGAGGCCGAGAGGTTGAGGCTGCATTTCCTGAGCCTCTCAAGGGCCCTATTCTTCGCAAG
GTGCAGTTTCAGACAGTATCTCGTCTCGATAATCTCGTGGACATGATTTATGATGAGTTCAAGAGCGACTACTAC
CCAGGGGAAGAAGTGACAGTCAACATGGACGGGGGCGACAAATTACACGGGCTTGTCCGTGAAAAGACTGCCTTT
GGCCCCCGTGCACTGCCCGATGGCTCATTGACACAGCCTACCGCTCGTTATCTAGTCAACATCAAGGACTCCAAC
GAGGAGACGTTTCTTCCTGCTGAGCGCATCTGCCGCGACCGCGGCGTCTTCACCAAGTCGATGCTACGCTCCTTT
ATTAAGAAGACTGTTACGCGCGAATCATGGAACGGAGCGCCATGGTTGGTGATGCATGATTATGCTGGAACATAC
CACATTGACTCTCGAATACCGGCTTCGCTTCGTCACGATGCAAAGATCCAGCAGCGCAAGCAGCTCCAGGCCCTG
AAGCGTGCTTCGTCATACGAAGCCAACAATGCCAACGGACACGGCCCGAGTGCACCACAGTCGGGTCCCGTTCGC
TTGCCCGAACTTAAGCCGGCCCCCAAGAGCCACAAGAGCAAGCAGGCTCAGGCTGCCAAAGGTCTCCGGTGGCCA
TTAAACATGCCGGCCAACGGAGCCAATGGAAGCCTGCCGCCCCAAGACCAGGGAGCTGCGGCTCGAGACCCGACG
CCACCGCCCCCGCCACCGCCCCCCAAGTACCCGATCGAGGACTTGCTTCTCGAGCCCAAGGAGGGCAGCGTACGG
CCCCGGCTCAAGTTTATGTGCAGAGATGCTCCGGTTGAGGGTGTGCCAGTGGATGCTGCGTATCGCCACATTGAC
ATGGACACGGTCGGCGCGCTGCTCGAGACGTGGGACACAATCAACGTCTACTGTGAGATCTTTAAGCTTGACTCG
TTTACCTTTGACGACTACATGGAGGCTTTGAAGGTGGCATCCCAACAGGTGCACGTTGAACTGTTTGAAGAGATA
CACTGTGCCATTCTGAAGATTCTTGTCAACTCGGAACTTGATGGCGGCAAGGTCAATATCGTGCTTCCGGAGCTC
GAAAAAACAAGCGACGACGAAGATGGCGCAGATGCAACGGCGGGCAGCGTCGTGGCAACGCCTGATGCAGAACCG
GAACCAAAGCCTACCGGACGGGCCACTCGTAGCAGCCTCGCAAAACTCGAGGCCGAACGCCTAGCCGCCGAGGCG
GCCGCTGCTGAAGAACAAAGCATCAAGGCGGAGCTTGAATACAAGCAGCGGGCTGAGCAAATGCTCCAAGAGTAC
GACTGGGTCGAGCATTTGCGCAAGCGAGATTTTGCACATGGCGGCTGGCAGCGCATCATTGTTGGCTTGCTGCAC
CAAATCTCCAAGAGGGAGCGGCAGCAAGAGGCCTGTGAGAGCCTTTTGCGAAAGCTGGTGCCAAGCAATGGAGAG
CCTACACAAGAGGCGGTGCGACAGACGTACTGGAGTCTCGACTTCAACAGCCGCGTCATGGTACTTCAGATTCTC
TGCATGCTTACCATGGAGACGGGTGCTGTGCGGGCCTACATGGACGACTGCAGTGAGACAATGACCAAGTATCGA
AAGGAGAGGATTGAATGGCAGCGGAAGCGGAAGCAAGCGTGAGTCTTTGTTGCTCCTTGTTGCTCCTTGTCCTCT
GCCCCTTGTTCAAGGATGCACTAAAAGTGGAATATAGGATTGAGGAACTGCGTCAGTATAATGACGAGCGCAAGA
CCTTGGTGCCTGACAGAGCAACGCCCGAGTCACCAGCTCAGAACTCTAGAAGAGACGAGGATGATAAGATGACTG
ACGCGGACGAGTCGCTTGTGACCAAGGACGATTACGCAGAAGGCACTCCGGACGAAAACGGCAAGGGGCAAAAAA
AGCGCCGAAACCGTGGCCAACATCAAGACAAGCAGCGGAAGCGTGACGAGAGCAAGGGCGGCGGGGTGGATCGCG
ACAAGAAGAAGGAGGTTAAGCCACCCGTCAGATTGCCACCGCAGCAAATGAAGCAGTACAGCAAGCTGCTCAAGG
AAATTGAAAAGAGGGAAAGCCTCATCAAGTCTTGTGAGGAGGAGATTGGGATTCTCGAAAATGACCTTCGCGAGG
CCGACTGCCCACGTACCCGGGTGCTTGGAAAGGATCGATTCTGGAACAGATACTACTGGTTTGAGCGCAACGGCA
TGCCATATGCAGGTCTGCCCAACAGTTCGACTGCTTACGCCGAATACGCCAATGGGTGTATCTGGGTCCAGGGGC
CGGATAATCTTGAGCGCGAGGGCTTTATCGAGGTGCCCCCAATGGACCAAGAGGATCATATCACGCGCTTCAACA
TGACGATAGCTGAGCGCAAGGCCAAGGAGGAGGACGGGACGAGCGTCTTCAACGCGAAGCAATGGGGCTACATTT
GCGACAGCGAAGACGTTGATCGGCTGATTCGATGGCTCGATCCGCGCGGTCTCAACGAGGTCAAGCTGCGCAAGG
AGTTACTGGCATATCGAGAAAAGATTTCGACGCACATGGCCTGTCGCAAGTCGTACCTGGCAGATGGCGATGACC
AGGCAGACAAGAAGGAGGACACGGTGGCCAAGCGCACGAGTACTCGCATCCGGGACAAGACACCGCCAGAGGATC
CCAAGTATAGGTGTCTGCAGTGGCACAACTCGATGGCACTCGACGATCTCGGGCATTTACATGCTGAACAGCCTC
CACCGCCACGGGCTCGCAAGCAAACCAAGAAGCGTGAGGCCATGGCTGACCTTGGGGGACGGGCACCCAAGACGC
GACGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail