Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4869
Gene name
LocationContig_421:5940..6639
Strand-
Gene length (bp)699
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01323 DSBA DSBA-like thioredoxin domain 5.6E-33 6 212

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6603
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4869 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4784
Ophiocordyceps subramaniannii Hirsu2|3427

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4869
MTKISISVTSDTVCPWCYVGRRQLQRAQGLWLQQDANSGDSFSVTFVPYQLEPTWPQGPDSSRNKQQFYNGKFGP
QHTRLIQQRLENIGSQLGINFRWGGRIGNSKDSHRLIHLAKSYGNSVELAVVDGLFAAYFEKEQDITSHDILRHV
ATRAGIPAQDFQDAIVHGDKGGAEVDEATTLARSSGVTGVPFFNIQSRFHVSGALDAKDFLKIFQKVKAHEGGSP
VSDTELD*
Coding >OphauG2|4869
ATGACCAAAATTTCCATTTCCGTCACTTCAGACACAGTCTGTCCCTGGTGCTATGTTGGCCGCCGTCAGCTCCAG
CGCGCCCAAGGCCTCTGGCTCCAACAAGACGCCAACTCTGGAGACTCCTTCTCCGTCACATTTGTCCCCTACCAG
CTCGAACCAACGTGGCCCCAGGGCCCCGACTCAAGCCGCAACAAGCAACAGTTTTACAATGGCAAATTCGGCCCT
CAACACACCCGCCTCATACAGCAGCGCCTCGAAAATATCGGCAGCCAACTCGGCATCAACTTTAGATGGGGCGGC
CGTATAGGCAATTCAAAAGACTCGCACCGCCTGATTCATCTCGCAAAGTCCTACGGCAACAGCGTCGAGCTCGCT
GTTGTCGATGGCTTGTTTGCCGCCTACTTTGAAAAGGAGCAAGATATTACTTCACACGACATACTGCGCCATGTC
GCCACCCGTGCCGGCATCCCGGCGCAAGACTTCCAAGACGCTATTGTGCATGGCGACAAGGGCGGCGCCGAGGTT
GATGAGGCGACAACGCTGGCACGGTCTAGTGGAGTTACTGGTGTTCCTTTCTTCAATATTCAGAGCCGCTTCCAC
GTCAGTGGCGCACTAGACGCCAAGGATTTCCTCAAAATATTCCAAAAGGTCAAGGCTCATGAAGGCGGCAGCCCT
GTTTCTGATACAGAGCTGGATTAG
Transcript >OphauG2|4869
ATGACCAAAATTTCCATTTCCGTCACTTCAGACACAGTCTGTCCCTGGTGCTATGTTGGCCGCCGTCAGCTCCAG
CGCGCCCAAGGCCTCTGGCTCCAACAAGACGCCAACTCTGGAGACTCCTTCTCCGTCACATTTGTCCCCTACCAG
CTCGAACCAACGTGGCCCCAGGGCCCCGACTCAAGCCGCAACAAGCAACAGTTTTACAATGGCAAATTCGGCCCT
CAACACACCCGCCTCATACAGCAGCGCCTCGAAAATATCGGCAGCCAACTCGGCATCAACTTTAGATGGGGCGGC
CGTATAGGCAATTCAAAAGACTCGCACCGCCTGATTCATCTCGCAAAGTCCTACGGCAACAGCGTCGAGCTCGCT
GTTGTCGATGGCTTGTTTGCCGCCTACTTTGAAAAGGAGCAAGATATTACTTCACACGACATACTGCGCCATGTC
GCCACCCGTGCCGGCATCCCGGCGCAAGACTTCCAAGACGCTATTGTGCATGGCGACAAGGGCGGCGCCGAGGTT
GATGAGGCGACAACGCTGGCACGGTCTAGTGGAGTTACTGGTGTTCCTTTCTTCAATATTCAGAGCCGCTTCCAC
GTCAGTGGCGCACTAGACGCCAAGGATTTCCTCAAAATATTCCAAAAGGTCAAGGCTCATGAAGGCGGCAGCCCT
GTTTCTGATACAGAGCTGGATTAG
Gene >OphauG2|4869
ATGACCAAAATTTCCATTTCCGTCACTTCAGACACAGTCTGTCCCTGGTGCTATGTTGGCCGCCGTCAGCTCCAG
CGCGCCCAAGGCCTCTGGCTCCAACAAGACGCCAACTCTGGAGACTCCTTCTCCGTCACATTTGTCCCCTACCAG
CTCGAACCAACGTGGCCCCAGGGCCCCGACTCAAGCCGCAACAAGCAACAGTTTTACAATGGCAAATTCGGCCCT
CAACACACCCGCCTCATACAGCAGCGCCTCGAAAATATCGGCAGCCAACTCGGCATCAACTTTAGATGGGGCGGC
CGTATAGGCAATTCAAAAGACTCGCACCGCCTGATTCATCTCGCAAAGTCCTACGGCAACAGCGTCGAGCTCGCT
GTTGTCGATGGCTTGTTTGCCGCCTACTTTGAAAAGGAGCAAGATATTACTTCACACGACATACTGCGCCATGTC
GCCACCCGTGCCGGCATCCCGGCGCAAGACTTCCAAGACGCTATTGTGCATGGCGACAAGGGCGGCGCCGAGGTT
GATGAGGCGACAACGCTGGCACGGTCTAGTGGAGTTACTGGTGTTCCTTTCTTCAATATTCAGAGCCGCTTCCAC
GTCAGTGGCGCACTAGACGCCAAGGATTTCCTCAAAATATTCCAAAAGGTCAAGGCTCATGAAGGCGGCAGCCCT
GTTTCTGATACAGAGCTGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail