Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|486
Gene name
LocationContig_111:12636..14882
Strand+
Gene length (bp)2246
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16420 ATG7_N Ubiquitin-like modifier-activating enzyme ATG7 N-terminus 3.5E-110 5 327
PF00899 ThiF ThiF family 2.8E-39 341 574

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q52CS0|ATG7_MAGO7 Ubiquitin-like modifier-activating enzyme ATG7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG7 PE=3 SV=2 5 692 0.0E+00
sp|A7EI75|ATG7_SCLS1 Ubiquitin-like modifier-activating enzyme atg7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg7 PE=3 SV=1 3 675 0.0E+00
sp|A7KAL8|ATG7_PENRW Ubiquitin-like modifier-activating enzyme atg7 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg7 PE=3 SV=1 5 687 0.0E+00
sp|A6QXC6|ATG7_AJECN Ubiquitin-like modifier-activating enzyme ATG7 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG7 PE=3 SV=1 5 662 0.0E+00
sp|Q5AWA2|ATG7_EMENI Ubiquitin-like modifier-activating enzyme atg7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg7 PE=3 SV=2 5 662 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q52CS0|ATG7_MAGO7 Ubiquitin-like modifier-activating enzyme ATG7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG7 PE=3 SV=2 5 692 0.0E+00
sp|A7EI75|ATG7_SCLS1 Ubiquitin-like modifier-activating enzyme atg7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg7 PE=3 SV=1 3 675 0.0E+00
sp|A7KAL8|ATG7_PENRW Ubiquitin-like modifier-activating enzyme atg7 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg7 PE=3 SV=1 5 687 0.0E+00
sp|A6QXC6|ATG7_AJECN Ubiquitin-like modifier-activating enzyme ATG7 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG7 PE=3 SV=1 5 662 0.0E+00
sp|Q5AWA2|ATG7_EMENI Ubiquitin-like modifier-activating enzyme atg7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg7 PE=3 SV=2 5 662 0.0E+00
sp|Q871U2|ATG7_NEUCR Ubiquitin-like modifier-activating enzyme atg7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-5 PE=3 SV=1 3 676 0.0E+00
sp|A7KAI6|ATG7_PICAN Ubiquitin-like modifier-activating enzyme ATG7 OS=Pichia angusta GN=ATG7 PE=3 SV=1 12 681 6.0E-179
sp|Q9D906|ATG7_MOUSE Ubiquitin-like modifier-activating enzyme ATG7 OS=Mus musculus GN=Atg7 PE=1 SV=1 5 681 2.0E-175
sp|O95352|ATG7_HUMAN Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens GN=ATG7 PE=1 SV=1 5 681 4.0E-174
sp|Q641Y5|ATG7_RAT Ubiquitin-like modifier-activating enzyme ATG7 OS=Rattus norvegicus GN=Atg7 PE=2 SV=1 5 681 8.0E-174
sp|Q5ZKY2|ATG7_CHICK Ubiquitin-like modifier-activating enzyme ATG7 OS=Gallus gallus GN=ATG7 PE=2 SV=1 5 681 2.0E-170
sp|Q94CD5|ATG7_ARATH Ubiquitin-like modifier-activating enzyme atg7 OS=Arabidopsis thaliana GN=ATG7 PE=1 SV=1 2 669 3.0E-170
sp|P0CM39|ATG7_CRYNB Ubiquitin-like modifier-activating enzyme ATG7 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG7 PE=3 SV=1 4 681 9.0E-164
sp|O93922|ATG7_PICPA Ubiquitin-like modifier-activating enzyme ATG7 OS=Komagataella pastoris GN=ATG7 PE=1 SV=1 2 681 3.0E-162
sp|P0CM38|ATG7_CRYNJ Ubiquitin-like modifier-activating enzyme ATG7 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG7 PE=3 SV=1 4 681 5.0E-162
sp|Q59PZ3|ATG7_CANAL Ubiquitin-like modifier-activating enzyme ATG7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG7 PE=3 SV=1 12 672 3.0E-161
sp|Q6BGV9|ATG7_DEBHA Ubiquitin-like modifier-activating enzyme ATG7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG7 PE=3 SV=2 5 673 9.0E-160
sp|A5DLC6|ATG7_PICGU Ubiquitin-like modifier-activating enzyme ATG7 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG7 PE=3 SV=2 4 679 3.0E-159
sp|A3LPA1|ATG7_PICST Ubiquitin-like modifier-activating enzyme ATG7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG7 PE=3 SV=2 6 668 4.0E-157
sp|O43069|ATG7_SCHPO Ubiquitin-like modifier-activating enzyme atg7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg7 PE=3 SV=2 5 680 9.0E-157
sp|A5E0T7|ATG7_LODEL Ubiquitin-like modifier-activating enzyme ATG7 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ATG7 PE=3 SV=1 5 686 3.0E-156
sp|Q756G8|ATG7_ASHGO Ubiquitin-like modifier-activating enzyme ATG7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG7 PE=3 SV=1 1 683 3.0E-151
sp|Q86CR9|ATG7_DICDI Ubiquitin-like modifier-activating enzyme atg7 OS=Dictyostelium discoideum GN=atg7 PE=3 SV=1 1 664 1.0E-149
sp|Q6CBC3|ATG7_YARLI Ubiquitin-like modifier-activating enzyme ATG7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG7 PE=3 SV=1 5 669 2.0E-149
sp|A7TEY0|ATG7_VANPO Ubiquitin-like modifier-activating enzyme ATG7 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG7 PE=3 SV=1 8 681 2.0E-147
sp|P38862|ATG7_YEAST Ubiquitin-like modifier-activating enzyme ATG7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG7 PE=1 SV=1 9 683 9.0E-144
sp|A6ZT79|ATG7_YEAS7 Ubiquitin-like modifier-activating enzyme ATG7 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG7 PE=3 SV=1 9 683 4.0E-143
sp|Q6CXW3|ATG7_KLULA Ubiquitin-like modifier-activating enzyme ATG7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG7 PE=3 SV=1 1 685 3.0E-139
sp|Q6FQY7|ATG7_CANGA Ubiquitin-like modifier-activating enzyme ATG7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG7 PE=3 SV=1 12 674 2.0E-132
sp|Q6CMC2|UBA4_KLULA Adenylyltransferase and sulfurtransferase UBA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBA4 PE=3 SV=1 356 569 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|486
MAMPLQFAAFTSEIELPFYSALFASKLDYDRLDDSARNLLGLYEPRIELPESSCRMLILGNALTSKSSPLGTARA
EGIIKNVNTLETFRGMDKTTMLQRAARQIWDAINDGTIYSIPSLLSSFIIVSYADLKKYKLMYWFAFPALHSYPQ
WHRSGPCESFSADECTALVDSVGTWRYSVDNREHGFFLAKKEKTAQSPSDDDDLVTALGFRWAVASLRHYETGFF
NGIPDEDRYVAFVDPSTYAEAPGWPLRNLLVLIRQRFHIKKVKILCYRDTRARRHEARSIVLPLETETAQQMDSG
VMPKVTGWERTRTGKLQAQQANLGEYMDPSRLADSSVDLNLKLMKWRLAPNIDLGRIRNIKCLLLGAGTLGGYVS
RNLLGWGVRKITFVDYGRVSFSNPVRQPLFEFNDCIDGGKPKATQASAMLKRIYPGVESEGHSLAVPMLGHPFTD
EGSTKADYEKLADLVNEHDVIFLLMDTRESRWLPTVMGKASGKIVMNAALGFDSYVVMRHGSEKKLENQATLGCY
FCNDVVAPADSMKDQTLDQQCTVTRPGVAGMASALLVELLTSLLQHPLGNDAPAPQITSGSVPERDPPNHPLGLV
PHQIRGYVSTFQNMVIRGHSYDNCSACSPRIIDAYRQGGWEFLKRALQEKDYVSELSGLAEVQRRADEMAAQMGW
SEEEEEDENVIVDQEAEVL*
Coding >OphauG2|486
ATGGCTATGCCGTTGCAGTTTGCGGCATTTACCTCGGAGATTGAGCTCCCTTTCTACTCTGCCCTCTTCGCCTCC
AAGCTCGACTATGACAGGCTGGACGACTCTGCTCGCAACCTGCTCGGACTATACGAGCCGCGAATTGAACTTCCT
GAATCGAGCTGTCGCATGTTGATATTGGGAAATGCTCTGACAAGCAAAAGCTCGCCTCTTGGCACAGCAAGGGCT
GAGGGTATCATCAAAAATGTCAATACCCTTGAGACTTTCCGAGGTATGGACAAGACTACAATGCTACAGAGAGCC
GCTCGACAGATATGGGACGCCATCAATGATGGCACGATATATTCCATCCCCTCGCTGCTCTCCTCATTCATCATC
GTCTCGTACGCCGACCTGAAGAAGTACAAACTTATGTACTGGTTTGCGTTTCCCGCGCTGCACTCATATCCCCAG
TGGCACCGCTCTGGACCTTGCGAGAGCTTCAGCGCCGACGAGTGTACCGCCCTCGTGGACAGTGTGGGCACGTGG
CGCTATAGCGTCGATAACCGCGAGCACGGCTTTTTCCTGGCCAAAAAAGAAAAAACGGCACAAAGCCCCTCTGAC
GATGATGACTTGGTGACTGCGCTCGGGTTCAGGTGGGCAGTGGCTTCGCTGCGCCATTACGAGACGGGTTTCTTC
AACGGCATTCCTGATGAAGACCGATACGTGGCTTTTGTTGATCCTTCAACATACGCTGAAGCTCCTGGGTGGCCT
CTGCGAAATCTTCTTGTACTCATCCGCCAAAGGTTCCATATAAAAAAGGTCAAGATTCTCTGTTATAGAGATACC
AGGGCCAGACGACACGAAGCTCGTAGCATCGTACTACCTCTTGAGACAGAAACAGCACAGCAAATGGATTCGGGT
GTAATGCCCAAAGTGACAGGCTGGGAACGGACCCGGACTGGAAAGCTACAGGCACAACAAGCGAACCTGGGAGAG
TACATGGATCCATCCAGGCTAGCCGATTCGTCAGTCGATTTGAACCTCAAGCTGATGAAGTGGCGACTGGCGCCA
AACATCGACTTGGGCCGCATCAGAAACATCAAGTGTCTCCTGCTTGGAGCCGGCACATTGGGTGGCTATGTGTCA
AGAAACTTGCTGGGATGGGGAGTGCGCAAGATTACTTTTGTAGACTATGGGCGAGTATCCTTCTCGAACCCTGTA
CGCCAACCGCTCTTTGAGTTTAACGATTGCATCGACGGAGGCAAACCCAAGGCAACACAAGCATCCGCAATGCTC
AAGAGAATCTACCCTGGAGTGGAAAGTGAAGGACACTCGTTGGCAGTGCCGATGCTGGGGCACCCATTCACTGAC
GAAGGGAGTACCAAGGCAGATTACGAAAAGCTTGCAGATCTCGTTAATGAGCACGATGTCATTTTCTTGCTCATG
GACACGCGTGAGTCGAGATGGCTGCCGACAGTCATGGGGAAAGCCTCGGGCAAGATTGTCATGAATGCGGCACTG
GGATTTGACTCTTACGTGGTGATGCGCCATGGATCGGAAAAGAAGCTGGAGAACCAAGCGACGTTGGGCTGCTAT
TTTTGCAATGATGTTGTAGCCCCAGCAGATTCTATGAAAGACCAGACGCTGGACCAACAGTGTACAGTGACGAGG
CCCGGAGTCGCTGGCATGGCATCCGCCCTTCTCGTCGAGCTGCTCACAAGTCTTTTGCAGCATCCACTGGGCAAT
GATGCGCCGGCACCCCAAATAACTTCAGGTTCGGTTCCAGAGCGAGACCCGCCAAATCACCCCTTGGGCCTGGTG
CCTCACCAGATTCGTGGATACGTCTCGACGTTTCAAAACATGGTGATACGTGGTCACTCATACGACAATTGCAGC
GCCTGTAGCCCAAGGATAATCGATGCATATCGCCAAGGCGGGTGGGAATTTCTGAAGCGGGCTCTGCAGGAAAAG
GACTATGTCTCGGAGCTCTCGGGGCTGGCAGAGGTACAGCGACGAGCTGACGAAATGGCGGCGCAAATGGGTTGG
TCGGAGGAGGAAGAAGAAGACGAAAATGTTATAGTGGACCAAGAAGCAGAAGTTTTGTGA
Transcript >OphauG2|486
ATGGCTATGCCGTTGCAGTTTGCGGCATTTACCTCGGAGATTGAGCTCCCTTTCTACTCTGCCCTCTTCGCCTCC
AAGCTCGACTATGACAGGCTGGACGACTCTGCTCGCAACCTGCTCGGACTATACGAGCCGCGAATTGAACTTCCT
GAATCGAGCTGTCGCATGTTGATATTGGGAAATGCTCTGACAAGCAAAAGCTCGCCTCTTGGCACAGCAAGGGCT
GAGGGTATCATCAAAAATGTCAATACCCTTGAGACTTTCCGAGGTATGGACAAGACTACAATGCTACAGAGAGCC
GCTCGACAGATATGGGACGCCATCAATGATGGCACGATATATTCCATCCCCTCGCTGCTCTCCTCATTCATCATC
GTCTCGTACGCCGACCTGAAGAAGTACAAACTTATGTACTGGTTTGCGTTTCCCGCGCTGCACTCATATCCCCAG
TGGCACCGCTCTGGACCTTGCGAGAGCTTCAGCGCCGACGAGTGTACCGCCCTCGTGGACAGTGTGGGCACGTGG
CGCTATAGCGTCGATAACCGCGAGCACGGCTTTTTCCTGGCCAAAAAAGAAAAAACGGCACAAAGCCCCTCTGAC
GATGATGACTTGGTGACTGCGCTCGGGTTCAGGTGGGCAGTGGCTTCGCTGCGCCATTACGAGACGGGTTTCTTC
AACGGCATTCCTGATGAAGACCGATACGTGGCTTTTGTTGATCCTTCAACATACGCTGAAGCTCCTGGGTGGCCT
CTGCGAAATCTTCTTGTACTCATCCGCCAAAGGTTCCATATAAAAAAGGTCAAGATTCTCTGTTATAGAGATACC
AGGGCCAGACGACACGAAGCTCGTAGCATCGTACTACCTCTTGAGACAGAAACAGCACAGCAAATGGATTCGGGT
GTAATGCCCAAAGTGACAGGCTGGGAACGGACCCGGACTGGAAAGCTACAGGCACAACAAGCGAACCTGGGAGAG
TACATGGATCCATCCAGGCTAGCCGATTCGTCAGTCGATTTGAACCTCAAGCTGATGAAGTGGCGACTGGCGCCA
AACATCGACTTGGGCCGCATCAGAAACATCAAGTGTCTCCTGCTTGGAGCCGGCACATTGGGTGGCTATGTGTCA
AGAAACTTGCTGGGATGGGGAGTGCGCAAGATTACTTTTGTAGACTATGGGCGAGTATCCTTCTCGAACCCTGTA
CGCCAACCGCTCTTTGAGTTTAACGATTGCATCGACGGAGGCAAACCCAAGGCAACACAAGCATCCGCAATGCTC
AAGAGAATCTACCCTGGAGTGGAAAGTGAAGGACACTCGTTGGCAGTGCCGATGCTGGGGCACCCATTCACTGAC
GAAGGGAGTACCAAGGCAGATTACGAAAAGCTTGCAGATCTCGTTAATGAGCACGATGTCATTTTCTTGCTCATG
GACACGCGTGAGTCGAGATGGCTGCCGACAGTCATGGGGAAAGCCTCGGGCAAGATTGTCATGAATGCGGCACTG
GGATTTGACTCTTACGTGGTGATGCGCCATGGATCGGAAAAGAAGCTGGAGAACCAAGCGACGTTGGGCTGCTAT
TTTTGCAATGATGTTGTAGCCCCAGCAGATTCTATGAAAGACCAGACGCTGGACCAACAGTGTACAGTGACGAGG
CCCGGAGTCGCTGGCATGGCATCCGCCCTTCTCGTCGAGCTGCTCACAAGTCTTTTGCAGCATCCACTGGGCAAT
GATGCGCCGGCACCCCAAATAACTTCAGGTTCGGTTCCAGAGCGAGACCCGCCAAATCACCCCTTGGGCCTGGTG
CCTCACCAGATTCGTGGATACGTCTCGACGTTTCAAAACATGGTGATACGTGGTCACTCATACGACAATTGCAGC
GCCTGTAGCCCAAGGATAATCGATGCATATCGCCAAGGCGGGTGGGAATTTCTGAAGCGGGCTCTGCAGGAAAAG
GACTATGTCTCGGAGCTCTCGGGGCTGGCAGAGGTACAGCGACGAGCTGACGAAATGGCGGCGCAAATGGGTTGG
TCGGAGGAGGAAGAAGAAGACGAAAATGTTATAGTGGACCAAGAAGCAGAAGTTTTGTGA
Gene >OphauG2|486
ATGGCTATGCCGTTGCAGTTTGCGGCATTTACCTCGGAGATTGAGCTCCCTTTCTACTCTGCCCTCTTCGCCTCC
AAGCTCGACTATGACAGGCTGGACGACTCTGCTCGCAACCTGCTCGGACTATACGAGCCGCGAATTGAACTTCCT
GAATCGAGCTGTCGCATGTTGATATTGGGAAATGCTCTGACAAGCAAAAGGTCAGTTTAGTTGTCAAGGTCAACA
AGCAGGGCTGATTTGTACCTAGCTCGCCTCTTGGCACAGCAAGGGCTGAGGGTATCATCAAAAATGTCAATACCC
TTGAGACTTTCCGAGGTATGGACAAGACTACAATGCTACAGAGAGCCGCTCGACAGGTATGCTGAGTGCCAAAAG
CTGCTCGAAACAACTACTGACATACATAGATATGGGACGCCATCAATGATGGCACGATATATTCCATCCCCTCGC
TGCTCTCCTCATTCATCATCGTCTCGTACGCCGACCTGAAGAAGTACAAACTTATGTACTGGTTTGCGTTTCCCG
CGCTGCACTCATATCCCCAGTGGCACCGCTCTGGACCTTGCGAGAGCTTCAGCGCCGACGAGTGTACCGCCCTCG
TGGACAGTGTGGGCACGTGGCGCTATAGCGTCGATAACCGCGAGCACGGCTTTTTCCTGGCCAAAAAAGAAAAAA
CGGCACAAAGCCCCTCTGACGATGATGACTTGGTGACTGCGCTCGGGTTCAGGTGGGCAGTGGCTTCGCTGCGCC
ATTACGAGACGGGTTTCTTCAACGGCATTCCTGATGAAGACCGATACGTGGCTTTTGTTGATCCTTCAACATACG
CTGAAGCTCCTGGGTGGCCTCTGCGAAATCTTCTTGTACTCATCCGCCAAAGGTTCCATATAAAAAAGGTCAAGA
TTCTCTGTTATAGAGATACCAGGGCCAGACGACACGAAGCTCGTAGCATCGTACTACCTCTTGAGACAGAAACAG
CACAGCAAATGGATTCGGGTGTAATGCCCAAAGTGACAGGCTGGGAACGGACCCGGACTGGAAAGCTACAGGCAC
AACAAGCGAACCTGGGAGAGTACATGGATCCATCCAGGCTAGCCGATTCGTCAGTCGATTTGAACCTCAAGCTGA
TGAAGTGGCGACTGGCGCCAAACATCGACTTGGGCCGCATCAGAAACATCAAGTGTCTCCTGCTTGGAGCCGGCA
CATTGGGTGGCTATGTGTCAAGAAACTTGCTGGGATGGGGAGTGCGCAAGATTACTTTTGTAGACTATGGGCGAG
TATCCTTCTCGAACCCTGTACGCCAACCGCTCTTTGAGTTTAACGATTGCATCGACGGAGGCAAACCCAAGGCAA
CACAAGCATCCGCAATGCTCAAGAGAATCTACCCTGGAGTGGAAAGTGAAGGACACTCGTTGGCAGTGCCGATGC
TGGGGCACCCATTCACTGACGAAGGGAGTACCAAGGCAGATTACGAAAAGCTTGCAGATCTCGTTAATGAGCACG
ATGTCATTTTCTTGCTCATGGACACGCGTGAGTCGAGATGGCTGCCGACAGTCATGGGGAAAGCCTCGGGCAAGA
TTGTCATGAATGCGGCACTGGGATTTGACTCTTACGTGGTGATGCGCCATGGATCGGAAAAGAAGCTGGAGAACC
AAGCGACGTTGGGCTGCTATTTTTGCAATGATGTTGTAGCCCCAGCAGATGTGAGTATTCAATCCCTTGGACGCC
CCTCAATTCAAGGCACCAATGGGTCGCTGATGGGCATACAGTCTATGAAAGACCAGACGCTGGACCAACAGTGTA
CAGTGACGAGGCCCGGAGTCGCTGGCATGGCATCCGCCCTTCTCGTCGAGCTGCTCACAAGTCTTTTGCAGCATC
CACTGGGCAATGATGCGCCGGCACCCCAAATAACTTCAGGTTCGGTTCCAGAGCGAGACCCGCCAAATCACCCCT
TGGGCCTGGTGCCTCACCAGATTCGTGGATACGTCTCGACGTTTCAAAACATGGTGATACGTGGTCACTCATACG
ACAATTGCAGCGCCTGTAGCCCAAGGATAATCGATGCATATCGCCAAGGCGGGTGGGAATTTCTGAAGCGGGCTC
TGCAGGAAAAGGACTATGTCTCGGAGCTCTCGGGGCTGGCAGAGGTACAGCGACGAGCTGACGAAATGGCGGCGC
AAATGGGTTGGTCGGAGGAGGAAGAAGAAGACGAAAATGTTATAGTGGACCAAGAAGCAGAAGTTTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail