Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4854
Gene name
LocationContig_42:25222..26053
Strand-
Gene length (bp)831
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1318
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4854 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5299
Ophiocordyceps camponoti-floridani Ophcf2|00783
Ophiocordyceps camponoti-rufipedis Ophun1|5259
Ophiocordyceps kimflemingae Ophio5|2609
Ophiocordyceps subramaniannii Hirsu2|10676

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4854
MYACFAGGSENKVPQNFEAKEVVDLQDEAVDPNLELGVTVYFPQVSANQVIMYDTSTSPKLASACLDFVEQMGMG
VSNVVLSHKHGDHTAGLESKDLDKIDVVAQENTKSALSQGKGRVPDETFKQKANLGSGNNKVALMHFTAHTNDGT
AACMGNLCLMGDECEDNIPFIAEPDRVVDQAKNLKQTIQTLESQSVDKVCPAHGNGATIFDGCFGLGLCKSNLKY
LQLISSDTENTCAQTLQQLAPKIGRKEKDITQVYAEIHQQNCKAVASANGQ*
Coding >OphauG2|4854
ATGTATGCTTGTTTTGCTGGAGGATCGGAGAACAAGGTGCCGCAAAACTTTGAGGCCAAGGAGGTGGTGGATTTG
CAAGATGAAGCTGTGGACCCAAACCTTGAGCTGGGCGTGACGGTCTACTTCCCCCAGGTTTCGGCAAACCAGGTC
ATCATGTACGACACGTCGACATCGCCAAAACTGGCCTCTGCATGTCTTGATTTCGTCGAGCAAATGGGCATGGGA
GTCAGCAACGTTGTGCTTAGCCACAAGCACGGGGACCACACGGCCGGGCTCGAATCCAAAGACCTGGACAAGATC
GACGTTGTTGCACAGGAAAACACCAAAAGCGCACTGAGCCAGGGCAAGGGACGGGTTCCCGATGAAACCTTTAAG
CAGAAAGCAAACCTTGGGTCTGGCAATAACAAGGTTGCTTTGATGCACTTTACAGCTCACACAAACGATGGAACG
GCAGCATGCATGGGCAACCTGTGTCTGATGGGAGACGAGTGCGAAGACAACATTCCCTTTATCGCCGAACCAGAC
CGAGTCGTGGACCAGGCCAAGAACTTGAAGCAGACGATACAAACACTCGAGTCCCAGTCGGTGGACAAGGTGTGT
CCTGCGCATGGAAACGGGGCAACCATTTTTGACGGATGCTTTGGCCTGGGGCTCTGCAAGTCGAATCTCAAATAC
TTGCAGCTGATATCCAGCGACACGGAGAATACCTGTGCTCAGACATTGCAGCAACTGGCACCCAAGATTGGCCGC
AAGGAAAAGGACATTACGCAGGTCTATGCGGAAATTCACCAGCAAAACTGCAAGGCTGTGGCGAGTGCTAATGGA
CAGTGA
Transcript >OphauG2|4854
ATGTATGCTTGTTTTGCTGGAGGATCGGAGAACAAGGTGCCGCAAAACTTTGAGGCCAAGGAGGTGGTGGATTTG
CAAGATGAAGCTGTGGACCCAAACCTTGAGCTGGGCGTGACGGTCTACTTCCCCCAGGTTTCGGCAAACCAGGTC
ATCATGTACGACACGTCGACATCGCCAAAACTGGCCTCTGCATGTCTTGATTTCGTCGAGCAAATGGGCATGGGA
GTCAGCAACGTTGTGCTTAGCCACAAGCACGGGGACCACACGGCCGGGCTCGAATCCAAAGACCTGGACAAGATC
GACGTTGTTGCACAGGAAAACACCAAAAGCGCACTGAGCCAGGGCAAGGGACGGGTTCCCGATGAAACCTTTAAG
CAGAAAGCAAACCTTGGGTCTGGCAATAACAAGGTTGCTTTGATGCACTTTACAGCTCACACAAACGATGGAACG
GCAGCATGCATGGGCAACCTGTGTCTGATGGGAGACGAGTGCGAAGACAACATTCCCTTTATCGCCGAACCAGAC
CGAGTCGTGGACCAGGCCAAGAACTTGAAGCAGACGATACAAACACTCGAGTCCCAGTCGGTGGACAAGGTGTGT
CCTGCGCATGGAAACGGGGCAACCATTTTTGACGGATGCTTTGGCCTGGGGCTCTGCAAGTCGAATCTCAAATAC
TTGCAGCTGATATCCAGCGACACGGAGAATACCTGTGCTCAGACATTGCAGCAACTGGCACCCAAGATTGGCCGC
AAGGAAAAGGACATTACGCAGGTCTATGCGGAAATTCACCAGCAAAACTGCAAGGCTGTGGCGAGTGCTAATGGA
CAGTGA
Gene >OphauG2|4854
ATGTATGCTTGTTTTGCTGGAGGATCGGAGAACAAGGTGCCGCAAAACTTTGAGGCCAAGGAGGTGGTGGATTTG
CAAGATGAAGCTGTGGACCCAAACCTTGAGCTGGGCGTGACGGTCTACTTCCCCCAGGTTTCGGCAAACCAGGTC
ATCATGTACGACACGTCGACATCGCCAAAACTGGCCTCTGCATGTCTTGATTTCGTCGAGCAAATGGGCATGGGA
GTCAGCAACGTTGTGCTTAGCCACAAGCACGGGGACCACACGGCCGGGCTCGAATCCAAAGACCTGGACAAGATC
GACGTTGTTGCACAGGAAAACACCAAAAGCGCACTGAGCCAGGGCAAGGGACGGGTTCCCGATGAAACCTTTAAG
CAGAAAGCAAACCTTGGGTCTGGCAATAACAAGGTTGCTTTGATGCACTTTACAGCTCACACAAACGATGGAACG
GCAGCATGCATGGGCAACCTGTGTCTGATGGGAGACGAGTGCGAAGACAACATTCCCTTTATCGCCGAACCAGAC
CGAGTCGTGGACCAGGCCAAGAACTTGAAGCAGACGATACAAACACTCGAGTCCCAGTCGGTGGACAAGGTGTGT
CCTGCGCATGGAAACGGGGCAACCATTTTTGACGGATGCTTTGGCCTGGGGCTCTGCAAGTCGAATCTCAAATAC
TTGCAGCTGATATCCAGCGACACGGAGAATACCTGTGCTCAGACATTGCAGCAACTGGCACCCAAGATTGGCCGC
AAGGAAAAGGACATTACGCAGGTCTATGCGGAAATTCACCAGCAAAACTGCAAGGCTGTGGCGAGTGCTAATGGA
CAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail