Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4844
Gene name
LocationContig_419:12932..14975
Strand+
Gene length (bp)2043
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05536 Neurochondrin Neurochondrin 1.0E-82 15 517

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74447|YCG2_SCHPO Uncharacterized protein C16C4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.02c PE=1 SV=1 16 506 5.0E-16

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3224
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4844 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6943
Ophiocordyceps camponoti-floridani Ophcf2|01884
Ophiocordyceps camponoti-rufipedis Ophun1|4668
Ophiocordyceps kimflemingae Ophio5|4045
Ophiocordyceps subramaniannii Hirsu2|582

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4844
MVDHKDASPSPPIISLEKIKDALKSKDDTQRFVGLALTKSLLDNSQQHRQDEQVIQDLWTSLSPRFLDRLLRTGS
KPDANDAKQMLDLAASVMHTFAALLPESSRSEAKFTARIPAIVGALLYSSSETAHLLLQLLHGLVSNSNGARALV
QIDDVSPLTELAPSHALVFTIVSFAWLNVMASQQNMAPLASKLDSTLQGLVSSFMGTDAVTLLGFLASFLRQADA
SMLQPRPKWLKAVVGYIHNLVSSRPAPEARAAYTNATASLLQTYPLDAPKLLFADDKEKYKPWGYLVVNLVLIDI
RSSAPSLLEQLNAPHYADMSRRLASAFDIMSIFIGYLVRCLEDESLHSLFISPDNLLKLRSAMTDTMSVTIDYLR
DRWDASVAGALGLHPDARSAKAETWTGSHLTLPWDSLADSASNDALMLAALRALALWLREDDNDVLRKQASGLMD
MLMHLYRHRDLGKLDFTSPVLVACEALITIRQGREQFLVNDGWQVLGKDLTAVMQDSGTVNDENSASRGTDIVRL
LTYVVQEEPGGVIEDWMNLITHAAAWNVTAQGESPVAVQEFQVAVLQLCNTLLVKARLGIRTRYRHSIRAIRGIA
SQLSSSIGDESPVRDTMEDVLTNIDGLVVGMPPEFR*
Coding >OphauG2|4844
ATGGTGGATCATAAAGATGCTTCTCCTAGCCCACCCATCATCAGTCTCGAGAAGATTAAAGACGCCTTGAAATCA
AAAGACGACACGCAGAGATTTGTCGGCCTGGCTCTTACAAAGTCGCTTCTCGACAACTCGCAACAGCACCGCCAG
GATGAGCAAGTCATTCAAGACTTGTGGACCAGCCTCTCGCCCAGATTCCTCGATCGCTTGTTGCGCACAGGATCA
AAGCCCGACGCCAACGATGCCAAGCAGATGCTGGATCTAGCAGCCTCAGTCATGCATACATTTGCTGCTCTGTTG
CCCGAATCGTCCAGGTCCGAGGCCAAGTTTACCGCGCGCATCCCCGCCATTGTTGGCGCCTTGCTATACAGCTCG
AGCGAGACTGCCCACCTGCTGTTGCAGCTGCTGCATGGCCTCGTCAGCAATTCCAATGGGGCGCGAGCGCTGGTC
CAAATTGACGATGTGAGCCCTTTGACTGAGCTTGCGCCCAGCCATGCCTTGGTTTTCACCATTGTCTCCTTTGCC
TGGCTCAATGTCATGGCTTCACAACAAAACATGGCGCCCTTGGCTTCAAAGCTTGACTCTACCTTGCAGGGCCTG
GTTTCATCATTCATGGGCACCGACGCTGTCACCTTGCTTGGATTTCTGGCATCCTTTCTGCGGCAAGCAGATGCC
AGTATGCTGCAACCGCGGCCCAAGTGGCTAAAAGCTGTCGTCGGCTACATCCACAATCTGGTCTCAAGCCGGCCA
GCTCCGGAGGCCCGGGCTGCCTACACAAATGCCACTGCTTCCCTTCTTCAGACGTACCCTCTAGACGCACCCAAG
CTGTTGTTTGCTGACGACAAGGAGAAATATAAACCATGGGGCTACCTTGTCGTCAACCTCGTGCTTATCGATATT
CGGTCATCAGCGCCCTCACTGCTTGAGCAACTCAACGCCCCCCACTACGCAGACATGTCGCGACGGCTGGCTTCG
GCTTTTGATATAATGTCCATCTTTATTGGATACCTCGTTCGTTGTCTAGAAGACGAATCGCTCCACTCTTTATTC
ATATCTCCCGACAATCTACTTAAGCTGCGCAGTGCCATGACGGACACCATGTCGGTGACTATCGACTACCTTCGC
GATAGATGGGATGCTTCCGTTGCTGGTGCCCTGGGCCTTCATCCCGACGCTCGCAGCGCCAAGGCGGAGACATGG
ACGGGCTCACACCTCACCCTGCCGTGGGACTCGCTCGCCGATTCGGCCAGTAATGATGCTCTGATGCTTGCTGCC
CTCCGCGCACTTGCTCTCTGGCTGAGAGAAGACGACAATGATGTGCTGCGCAAGCAAGCCTCGGGTCTGATGGAC
ATGCTTATGCATCTTTACCGTCATAGAGACCTCGGCAAGCTTGACTTTACATCGCCCGTCCTTGTTGCTTGTGAA
GCTCTCATTACAATTCGCCAAGGACGGGAACAGTTTTTGGTCAATGATGGCTGGCAGGTCTTGGGCAAAGACTTG
ACGGCTGTGATGCAAGATAGTGGTACTGTAAACGACGAAAACTCGGCGTCGCGCGGTACCGATATTGTACGCCTT
CTTACCTACGTGGTACAAGAGGAACCAGGGGGTGTAATTGAGGACTGGATGAATCTCATTACCCATGCTGCTGCT
TGGAATGTGACGGCACAAGGCGAGAGCCCCGTGGCTGTGCAAGAATTCCAAGTCGCCGTCTTGCAGCTCTGCAAT
ACATTGCTAGTAAAGGCGAGGCTGGGTATCAGGACGAGATACAGACATTCCATTCGCGCCATCCGAGGCATTGCA
TCTCAGTTGAGTTCAAGCATTGGAGATGAAAGTCCTGTCAGGGATACCATGGAAGACGTCCTGACCAATATCGAT
GGATTGGTCGTGGGAATGCCTCCTGAATTTCGTTGA
Transcript >OphauG2|4844
ATGGTGGATCATAAAGATGCTTCTCCTAGCCCACCCATCATCAGTCTCGAGAAGATTAAAGACGCCTTGAAATCA
AAAGACGACACGCAGAGATTTGTCGGCCTGGCTCTTACAAAGTCGCTTCTCGACAACTCGCAACAGCACCGCCAG
GATGAGCAAGTCATTCAAGACTTGTGGACCAGCCTCTCGCCCAGATTCCTCGATCGCTTGTTGCGCACAGGATCA
AAGCCCGACGCCAACGATGCCAAGCAGATGCTGGATCTAGCAGCCTCAGTCATGCATACATTTGCTGCTCTGTTG
CCCGAATCGTCCAGGTCCGAGGCCAAGTTTACCGCGCGCATCCCCGCCATTGTTGGCGCCTTGCTATACAGCTCG
AGCGAGACTGCCCACCTGCTGTTGCAGCTGCTGCATGGCCTCGTCAGCAATTCCAATGGGGCGCGAGCGCTGGTC
CAAATTGACGATGTGAGCCCTTTGACTGAGCTTGCGCCCAGCCATGCCTTGGTTTTCACCATTGTCTCCTTTGCC
TGGCTCAATGTCATGGCTTCACAACAAAACATGGCGCCCTTGGCTTCAAAGCTTGACTCTACCTTGCAGGGCCTG
GTTTCATCATTCATGGGCACCGACGCTGTCACCTTGCTTGGATTTCTGGCATCCTTTCTGCGGCAAGCAGATGCC
AGTATGCTGCAACCGCGGCCCAAGTGGCTAAAAGCTGTCGTCGGCTACATCCACAATCTGGTCTCAAGCCGGCCA
GCTCCGGAGGCCCGGGCTGCCTACACAAATGCCACTGCTTCCCTTCTTCAGACGTACCCTCTAGACGCACCCAAG
CTGTTGTTTGCTGACGACAAGGAGAAATATAAACCATGGGGCTACCTTGTCGTCAACCTCGTGCTTATCGATATT
CGGTCATCAGCGCCCTCACTGCTTGAGCAACTCAACGCCCCCCACTACGCAGACATGTCGCGACGGCTGGCTTCG
GCTTTTGATATAATGTCCATCTTTATTGGATACCTCGTTCGTTGTCTAGAAGACGAATCGCTCCACTCTTTATTC
ATATCTCCCGACAATCTACTTAAGCTGCGCAGTGCCATGACGGACACCATGTCGGTGACTATCGACTACCTTCGC
GATAGATGGGATGCTTCCGTTGCTGGTGCCCTGGGCCTTCATCCCGACGCTCGCAGCGCCAAGGCGGAGACATGG
ACGGGCTCACACCTCACCCTGCCGTGGGACTCGCTCGCCGATTCGGCCAGTAATGATGCTCTGATGCTTGCTGCC
CTCCGCGCACTTGCTCTCTGGCTGAGAGAAGACGACAATGATGTGCTGCGCAAGCAAGCCTCGGGTCTGATGGAC
ATGCTTATGCATCTTTACCGTCATAGAGACCTCGGCAAGCTTGACTTTACATCGCCCGTCCTTGTTGCTTGTGAA
GCTCTCATTACAATTCGCCAAGGACGGGAACAGTTTTTGGTCAATGATGGCTGGCAGGTCTTGGGCAAAGACTTG
ACGGCTGTGATGCAAGATAGTGGTACTGTAAACGACGAAAACTCGGCGTCGCGCGGTACCGATATTGTACGCCTT
CTTACCTACGTGGTACAAGAGGAACCAGGGGGTGTAATTGAGGACTGGATGAATCTCATTACCCATGCTGCTGCT
TGGAATGTGACGGCACAAGGCGAGAGCCCCGTGGCTGTGCAAGAATTCCAAGTCGCCGTCTTGCAGCTCTGCAAT
ACATTGCTAGTAAAGGCGAGGCTGGGTATCAGGACGAGATACAGACATTCCATTCGCGCCATCCGAGGCATTGCA
TCTCAGTTGAGTTCAAGCATTGGAGATGAAAGTCCTGTCAGGGATACCATGGAAGACGTCCTGACCAATATCGAT
GGATTGGTCGTGGGAATGCCTCCTGAATTTCGTTGA
Gene >OphauG2|4844
ATGGTGGATCATAAAGATGCTTCTCCTAGCCCACCCATCATCAGTCTCGAGAAGATTAAAGACGCCTTGAAATCA
AAAGACGACACGCAGAGATTTGTCGGCCTGGCTCTTACAAAGTCGCTTCTCGACAACTCGCAACAGCACCGCCAG
GATGAGCAAGTCATTCAAGACTTGTGGACCAGCCTCTCGCCCAGATTCCTCGATCGCTTGTTGCGCACAGGATCA
AAGCCCGACGCCAACGATGCCAAGCAGATGCTGGATCTAGCAGCCTCAGTCATGCATACATTTGCTGCTCTGTTG
CCCGAATCGTCCAGGTCCGAGGCCAAGTTTACCGCGCGCATCCCCGCCATTGTTGGCGCCTTGCTATACAGGTAA
TTGGCCGCTGGTTGCTCACCAGCTTCCAACTTTGCCCTTCTAACTTTTGTAATCGAGACAGCTCGAGCGAGACTG
CCCACCTGCTGTTGCAGCTGCTGCATGGCCTCGTCAGCAATTCCAATGGGGCGCGAGCGCTGGTCCAAATTGACG
ATGTGAGCCCTTTGACTGAGCTTGCGCCCAGCCATGCCTTGGTTTTCACCATTGTCTCCTTTGCCTGGCTCAATG
TCATGGCTTCACAACAAAACATGGCGCCCTTGGCTTCAAAGCTTGACTCTACCTTGCAGGGCCTGGTTTCATCAT
TCATGGGCACCGACGCTGTCACCTTGCTTGGATTTCTGGCATCCTTTCTGCGGCAAGCAGATGCCAGTGTAAGCA
CCGTGATGAGCTGCTCCTCGTTATTTGCGTGCTTGGCTGACTTTTTGTCTACATATGTAGATGCTGCAACCGCGG
CCCAAGTGGCTAAAAGCTGTCGTCGGCTACATCCACAATCTGGTCTCAAGCCGGCCAGCTCCGGAGGCCCGGGCT
GCCTACACAAATGCCACTGCTTCCCTTCTTCAGACGTACCCTCTAGACGCACCCAAGCTGTTGTTTGCTGACGAC
AAGGAGAAATATAAACCATGGGGCTACCTTGTCGTCAACCTCGTGCTTATCGATATTCGGTCATCAGCGCCCTCA
CTGCTTGAGCAACTCAACGCCCCCCACTACGCAGACATGTCGCGACGGCTGGCTTCGGCTTTTGATATAATGTCC
ATCTTTATTGGATACCTCGTTCGTTGTCTAGAAGACGAATCGCTCCACTCTTTATTCATATCTCCCGACAATCTA
CTTAAGCTGCGCAGTGCCATGACGGACACCATGTCGGTGACTATCGACTACCTTCGCGATAGATGGGATGCTTCC
GTTGCTGGTGCCCTGGGCCTTCATCCCGACGCTCGCAGCGCCAAGGCGGAGACATGGACGGGCTCACACCTCACC
CTGCCGTGGGACTCGCTCGCCGATTCGGCCAGTAATGATGCTCTGATGCTTGCTGCCCTCCGCGCACTTGCTCTC
TGGCTGAGAGAAGACGACAATGATGTGCTGCGCAAGCAAGCCTCGGGTCTGATGGACATGCTTATGCATCTTTAC
CGTCATAGAGACCTCGGCAAGCTTGACTTTACATCGCCCGTCCTTGTTGCTTGTGAAGCTCTCATTACAATTCGC
CAAGGACGGGAACAGTTTTTGGTCAATGATGGCTGGCAGGTCTTGGGCAAAGACTTGACGGCTGTGATGCAAGAT
AGTGGTACTGTAAACGACGAAAACTCGGCGTCGCGCGGTACCGATATTGTACGCCTTCTTACCTACGTGGTACAA
GAGGAACCAGGGGGTGTAATTGAGGACTGGATGAATCTCATTACCCATGCTGCTGCTTGGAATGTGACGGCACAA
GGCGAGAGCCCCGTGGCTGTGCAAGAATTCCAAGTCGCCGTCTTGCAGCTCTGCAATACATTGCTAGTAAAGGCG
AGGCTGGGTATCAGGACGAGATACAGACATTCCATTCGCGCCATCCGAGGCATTGCATCTCAGTTGAGTTCAAGC
ATTGGAGATGAAAGTCCTGTCAGGGATACCATGGAAGACGTCCTGACCAATATCGATGGATTGGTCGTGGGAATG
CCTCCTGAATTTCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail