Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4837
Gene name
LocationContig_418:6781..8064
Strand+
Gene length (bp)1283
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04180 LTV Low temperature viability protein 1.4E-120 8 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10191|LTV1_SCHPO Protein LTV1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ltv1 PE=1 SV=1 1 404 1.0E-44
sp|P34078|LTV1_YEAST Protein LTV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LTV1 PE=1 SV=2 4 407 6.0E-37
sp|Q0VC06|LTV1_BOVIN Protein LTV1 homolog OS=Bos taurus GN=LTV1 PE=2 SV=1 12 382 4.0E-09
sp|Q5U3J8|LTV1_DANRE Protein LTV1 homolog OS=Danio rerio GN=ltv1 PE=2 SV=1 3 98 1.0E-08
sp|Q5R8B2|LTV1_PONAB Protein LTV1 homolog OS=Pongo abelii GN=LTV1 PE=2 SV=1 12 382 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10191|LTV1_SCHPO Protein LTV1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ltv1 PE=1 SV=1 1 404 1.0E-44
sp|P34078|LTV1_YEAST Protein LTV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LTV1 PE=1 SV=2 4 407 6.0E-37
sp|Q0VC06|LTV1_BOVIN Protein LTV1 homolog OS=Bos taurus GN=LTV1 PE=2 SV=1 12 382 4.0E-09
sp|Q5U3J8|LTV1_DANRE Protein LTV1 homolog OS=Danio rerio GN=ltv1 PE=2 SV=1 3 98 1.0E-08
sp|Q5R8B2|LTV1_PONAB Protein LTV1 homolog OS=Pongo abelii GN=LTV1 PE=2 SV=1 12 382 7.0E-08
sp|Q96GA3|LTV1_HUMAN Protein LTV1 homolog OS=Homo sapiens GN=LTV1 PE=1 SV=1 12 382 7.0E-08
sp|Q7KN79|LTV1_DROME Protein LTV1 homolog OS=Drosophila melanogaster GN=CG7686 PE=1 SV=1 2 196 6.0E-07
sp|Q68FR7|LTV1_RAT Protein LTV1 homolog OS=Rattus norvegicus GN=Ltv1 PE=2 SV=1 12 93 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042274 ribosomal small subunit biogenesis Yes
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0044085 cellular component biogenesis No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4168
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4837 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3626
Ophiocordyceps camponoti-floridani Ophcf2|05067
Ophiocordyceps camponoti-rufipedis Ophun1|5227
Ophiocordyceps kimflemingae Ophio5|3629
Ophiocordyceps subramaniannii Hirsu2|8462

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4837
MAKSKWINKKTAQHFTLVHRPQNDPLIHDSDAPPMVLNPTKPSTGSSQFRCPDALASQMGVDATSIRANEGEAAS
YGVYFDDSEYDYMQHLRDLGQGGGQVVFVEATTSNEKKGKRTQTLAESLENMNLNPKASDSLGEEILPSKNLTSI
TYEAQQNVPDSISGFQPDMDPRLREVLEALDDDAYAQDENDDFFQQLAKDGRELDDVEFEEAQLDEDEGWESDRT
ARPSDEHKEKIAQLFPAQTEKPEEGPSQDWLEDFQKFKRDQKKGKATVAPSQSELQSTWTTTTNGGRRKKRKGAL
TDASSFSMSSSSLVRTEQLRFLDARYEKVYEKFNENLEDDMASVSAVSTASSVTGPLRSDFDGAIDDFLGNFTKP
GKRTCKKSKAQTGLQQLEEIRRDLGPARIRGR*
Coding >OphauG2|4837
ATGGCCAAAAGCAAGTGGATCAACAAGAAAACGGCGCAGCACTTTACCCTGGTGCACCGCCCGCAAAATGACCCC
CTCATCCATGACAGTGATGCCCCGCCCATGGTGCTCAATCCGACAAAGCCATCGACTGGCTCTTCTCAATTCAGG
TGTCCAGACGCCCTCGCATCACAAATGGGAGTTGATGCAACATCCATCCGAGCCAACGAAGGCGAAGCTGCTTCC
TACGGAGTCTACTTTGACGACTCGGAATACGATTACATGCAGCATCTACGAGACCTTGGTCAAGGGGGAGGACAA
GTTGTCTTTGTCGAGGCAACAACGTCAAACGAGAAAAAGGGGAAACGAACTCAAACACTGGCCGAGTCCCTAGAG
AATATGAATCTCAACCCCAAGGCCAGCGACAGCCTGGGCGAGGAGATTCTACCGTCCAAGAATCTCACAAGCATC
ACGTATGAAGCTCAGCAAAATGTGCCGGATTCTATAAGCGGTTTCCAGCCCGACATGGATCCGCGGTTACGAGAA
GTTCTAGAAGCCCTCGACGATGATGCATACGCCCAAGATGAAAATGACGACTTTTTCCAACAGCTAGCAAAGGAT
GGGCGAGAACTCGATGACGTGGAATTCGAAGAAGCACAATTAGATGAAGATGAAGGTTGGGAATCGGATCGCACT
GCCAGACCGAGCGATGAGCACAAGGAAAAGATTGCACAACTTTTTCCAGCGCAAACAGAAAAGCCTGAAGAAGGA
CCATCACAAGACTGGCTGGAGGACTTTCAAAAATTCAAGAGGGACCAGAAGAAGGGCAAGGCAACCGTGGCACCG
TCGCAGTCGGAGCTGCAATCTACATGGACCACAACCACCAACGGAGGCAGACGCAAGAAGCGCAAGGGCGCACTC
ACAGACGCATCAAGCTTTTCAATGTCGTCGTCGTCCTTGGTGCGGACGGAGCAGTTGAGATTTCTGGACGCACGT
TACGAGAAAGTTTACGAAAAGTTCAATGAGAACTTGGAGGACGACATGGCGTCGGTATCAGCCGTGTCAACGGCT
TCTAGCGTGACAGGGCCTTTGCGCAGCGACTTTGATGGCGCCATTGACGATTTCTTGGGCAATTTCACCAAGCCT
GGCAAGCGCACATGCAAAAAGTCCAAGGCCCAGACGGGTCTGCAGCAGTTGGAAGAAATCAGAAGAGACTTGGGT
CCTGCCCGTATTCGCGGACGATGA
Transcript >OphauG2|4837
ATGGCCAAAAGCAAGTGGATCAACAAGAAAACGGCGCAGCACTTTACCCTGGTGCACCGCCCGCAAAATGACCCC
CTCATCCATGACAGTGATGCCCCGCCCATGGTGCTCAATCCGACAAAGCCATCGACTGGCTCTTCTCAATTCAGG
TGTCCAGACGCCCTCGCATCACAAATGGGAGTTGATGCAACATCCATCCGAGCCAACGAAGGCGAAGCTGCTTCC
TACGGAGTCTACTTTGACGACTCGGAATACGATTACATGCAGCATCTACGAGACCTTGGTCAAGGGGGAGGACAA
GTTGTCTTTGTCGAGGCAACAACGTCAAACGAGAAAAAGGGGAAACGAACTCAAACACTGGCCGAGTCCCTAGAG
AATATGAATCTCAACCCCAAGGCCAGCGACAGCCTGGGCGAGGAGATTCTACCGTCCAAGAATCTCACAAGCATC
ACGTATGAAGCTCAGCAAAATGTGCCGGATTCTATAAGCGGTTTCCAGCCCGACATGGATCCGCGGTTACGAGAA
GTTCTAGAAGCCCTCGACGATGATGCATACGCCCAAGATGAAAATGACGACTTTTTCCAACAGCTAGCAAAGGAT
GGGCGAGAACTCGATGACGTGGAATTCGAAGAAGCACAATTAGATGAAGATGAAGGTTGGGAATCGGATCGCACT
GCCAGACCGAGCGATGAGCACAAGGAAAAGATTGCACAACTTTTTCCAGCGCAAACAGAAAAGCCTGAAGAAGGA
CCATCACAAGACTGGCTGGAGGACTTTCAAAAATTCAAGAGGGACCAGAAGAAGGGCAAGGCAACCGTGGCACCG
TCGCAGTCGGAGCTGCAATCTACATGGACCACAACCACCAACGGAGGCAGACGCAAGAAGCGCAAGGGCGCACTC
ACAGACGCATCAAGCTTTTCAATGTCGTCGTCGTCCTTGGTGCGGACGGAGCAGTTGAGATTTCTGGACGCACGT
TACGAGAAAGTTTACGAAAAGTTCAATGAGAACTTGGAGGACGACATGGCGTCGGTATCAGCCGTGTCAACGGCT
TCTAGCGTGACAGGGCCTTTGCGCAGCGACTTTGATGGCGCCATTGACGATTTCTTGGGCAATTTCACCAAGCCT
GGCAAGCGCACATGCAAAAAGTCCAAGGCCCAGACGGGTCTGCAGCAGTTGGAAGAAATCAGAAGAGACTTGGGT
CCTGCCCGTATTCGCGGACGATGA
Gene >OphauG2|4837
ATGGCCAAAAGCAAGTGGATGTAAGTCCTTCAGCTATTAAAATACTCTGTGCCTCTCTAACTCGTCAAACCGACT
TTAGCAACAAGAAAACGGCGCAGCACTTTACCCTGGTGCACCGCCCGCAAAATGACCCCCTCATCCATGACAGTG
ATGCCCCGCCCATGGTGCTCAATCCGACAAAGCCATCGACTGGCTCTTCTCAATTCAGGTGTCCAGACGCCCTCG
CATCACAAATGGGAGTTGATGCAACATCCATCCGAGCCAACGAAGGCGAAGCTGCTTCCTACGGAGTCTACTTTG
ACGACTCGGAATACGATTACATGCAGCATCTACGAGACCTTGGTCAAGGGGGAGGACAAGTTGTCTTTGTCGAGG
CAACAACGTCAAACGAGAAAAAGGGGAAACGAACTCAAACACTGGCCGAGTCCCTAGAGAATATGAATCTCAACC
CCAAGGCCAGCGACAGCCTGGGCGAGGAGATTCTACCGTCCAAGAATCTCACAAGCATCACGTATGAAGCTCAGC
AAAATGTGCCGGATTCTATAAGCGGTTTCCAGCCCGACATGGATCCGCGGTTACGAGAAGTTCTAGAAGCCCTCG
ACGATGATGCATACGCCCAAGATGAAAATGACGACTTTTTCCAACAGCTAGCAAAGGATGGGCGAGAACTCGATG
ACGTGGAATTCGAAGAAGCACAATTAGATGAAGATGAAGGTTGGGAATCGGATCGCACTGCCAGACCGAGCGATG
AGCACAAGGAAAAGATTGCACAACTTTTTCCAGCGCAAACAGAAAAGCCTGAAGAAGGACCATCACAAGACTGGC
TGGAGGACTTTCAAAAATTCAAGAGGGACCAGAAGAAGGGCAAGGCAACCGTGGCACCGTCGCAGTCGGAGCTGC
AATCTACATGGACCACAACCACCAACGGAGGCAGACGCAAGAAGCGCAAGGGCGCACTCACAGACGCATCAAGCT
TTTCAATGTCGTCGTCGTCCTTGGTGCGGACGGAGCAGTTGAGATTTCTGGACGCACGTTACGAGAAAGTTTACG
AAAAGTTCAATGAGAACTTGGAGGACGACATGGCGTCGGTATCAGCCGTGTCAACGGCTTCTAGCGTGACAGGGC
CTTTGCGCAGCGACTTTGATGGCGCCATTGACGATTTCTTGGGCAATTTCACCAAGCCTGGCAAGCGCACATGCA
AAAAGTCCAAGGCCCAGACGGGTCTGCAGCAGTTGGAAGAAATCAGAAGAGACTTGGGTCCTGCCCGTATTCGCG
GACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail