Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4836
Gene name
LocationContig_418:4345..6314
Strand-
Gene length (bp)1969
Transcript length (bp)1914
Coding sequence length (bp)1914
Protein length (aa) 638

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.6E-15 328 382

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53145|LSG1_YEAST Large subunit GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSG1 PE=1 SV=1 43 582 2.0E-179
sp|Q10190|LSG1_SCHPO Large subunit GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsg1 PE=3 SV=1 1 637 1.0E-178
sp|Q3UM18|LSG1_MOUSE Large subunit GTPase 1 homolog OS=Mus musculus GN=Lsg1 PE=1 SV=2 48 495 4.0E-146
sp|Q6NY89|LSG1_DANRE Large subunit GTPase 1 homolog OS=Danio rerio GN=lsg1 PE=2 SV=1 11 495 2.0E-141
sp|Q4R8L2|LSG1_MACFA Large subunit GTPase 1 homolog OS=Macaca fascicularis GN=LSG1 PE=2 SV=1 12 495 7.0E-137
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53145|LSG1_YEAST Large subunit GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSG1 PE=1 SV=1 43 582 2.0E-179
sp|Q10190|LSG1_SCHPO Large subunit GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsg1 PE=3 SV=1 1 637 1.0E-178
sp|Q3UM18|LSG1_MOUSE Large subunit GTPase 1 homolog OS=Mus musculus GN=Lsg1 PE=1 SV=2 48 495 4.0E-146
sp|Q6NY89|LSG1_DANRE Large subunit GTPase 1 homolog OS=Danio rerio GN=lsg1 PE=2 SV=1 11 495 2.0E-141
sp|Q4R8L2|LSG1_MACFA Large subunit GTPase 1 homolog OS=Macaca fascicularis GN=LSG1 PE=2 SV=1 12 495 7.0E-137
sp|Q9W590|LSG1_DROME Large subunit GTPase 1 homolog OS=Drosophila melanogaster GN=Ns3 PE=1 SV=1 11 583 7.0E-135
sp|Q9SJF1|LSG12_ARATH GTPase LSG1-2 OS=Arabidopsis thaliana GN=LSG1-2 PE=1 SV=1 59 508 2.0E-106
sp|Q9SHS8|LSG11_ARATH GTPase LSG1-1 OS=Arabidopsis thaliana GN=LSG1-1 PE=1 SV=1 59 494 7.0E-104
sp|Q5BJT6|LSG1_RAT Large subunit GTPase 1 homolog OS=Rattus norvegicus GN=Lsg1 PE=2 SV=1 260 495 9.0E-68
sp|Q5ZJD3|LSG1_CHICK Large subunit GTPase 1 homolog OS=Gallus gallus GN=LSG1 PE=2 SV=1 7 252 2.0E-67
sp|Q2YDM7|LSG1_BOVIN Large subunit GTPase 1 homolog OS=Bos taurus GN=LSG1 PE=2 SV=1 257 495 3.0E-67
sp|Q9H089|LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens GN=LSG1 PE=1 SV=2 277 495 4.0E-67
sp|Q5ZJD3|LSG1_CHICK Large subunit GTPase 1 homolog OS=Gallus gallus GN=LSG1 PE=2 SV=1 301 495 6.0E-67
sp|Q5BJT6|LSG1_RAT Large subunit GTPase 1 homolog OS=Rattus norvegicus GN=Lsg1 PE=2 SV=1 48 268 1.0E-65
sp|Q9H089|LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens GN=LSG1 PE=1 SV=2 11 266 9.0E-64
sp|Q2YDM7|LSG1_BOVIN Large subunit GTPase 1 homolog OS=Bos taurus GN=LSG1 PE=2 SV=1 48 252 5.0E-63
sp|P36916|GNL1_MOUSE Guanine nucleotide-binding protein-like 1 OS=Mus musculus GN=Gnl1 PE=1 SV=4 122 499 3.0E-41
sp|Q6C036|NOG2_YARLI Nucleolar GTP-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOG2 PE=3 SV=1 174 496 6.0E-31
sp|Q75DA4|NOG2_ASHGO Nucleolar GTP-binding protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOG2 PE=3 SV=1 174 491 6.0E-31
sp|O14236|NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nog2 PE=1 SV=1 152 497 6.0E-31
sp|P0CS94|NOG2_CRYNV Nucleolar GTP-binding protein 2 OS=Cryptococcus neoformans var. grubii GN=NOG2 PE=3 SV=1 174 492 7.0E-30
sp|J9VQ03|NOG2_CRYNH Nucleolar GTP-binding protein 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=NOG2 PE=3 SV=2 174 492 8.0E-30
sp|Q6FWS1|NOG2_CANGA Nucleolar GTP-binding protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOG2 PE=3 SV=1 174 498 8.0E-30
sp|Q9C923|NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana GN=NUG2 PE=1 SV=1 166 497 3.0E-29
sp|Q6CSP9|NOG2_KLULA Nucleolar GTP-binding protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOG2 PE=3 SV=1 174 495 6.0E-29
sp|A2XGQ1|NUG2_ORYSI Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. indica GN=NUG2 PE=3 SV=1 166 492 1.0E-28
sp|Q10LF7|NUG2_ORYSJ Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. japonica GN=NUG2 PE=1 SV=1 166 492 1.0E-28
sp|Q9M8Z5|NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana GN=NSN1 PE=2 SV=1 175 508 2.0E-28
sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens GN=GNL2 PE=1 SV=1 174 491 2.0E-28
sp|Q99LH1|NOG2_MOUSE Nucleolar GTP-binding protein 2 OS=Mus musculus GN=Gnl2 PE=1 SV=2 174 511 3.0E-28
sp|Q5TM59|GNL1_MACMU Guanine nucleotide-binding protein-like 1 OS=Macaca mulatta GN=GNL1 PE=3 SV=1 327 499 4.0E-28
sp|Q4R8D2|GNL1_MACFA Guanine nucleotide-binding protein-like 1 OS=Macaca fascicularis GN=GNL1 PE=2 SV=1 327 499 4.0E-28
sp|Q7YR35|GNL1_PANTR Guanine nucleotide-binding protein-like 1 OS=Pan troglodytes GN=GNL1 PE=3 SV=3 327 499 4.0E-28
sp|Q5RA07|GNL1_PONAB Guanine nucleotide-binding protein-like 1 OS=Pongo abelii GN=GNL1 PE=2 SV=1 327 499 4.0E-28
sp|P36915|GNL1_HUMAN Guanine nucleotide-binding protein-like 1 OS=Homo sapiens GN=GNL1 PE=1 SV=2 327 499 5.0E-28
sp|Q6MG06|GNL1_RAT Guanine nucleotide-binding protein-like 1 OS=Rattus norvegicus GN=Gnl1 PE=1 SV=1 327 499 1.0E-27
sp|Q9C3Z4|NOG2_PNECA Nucleolar GTP-binding protein 2 OS=Pneumocystis carinii GN=NOG2 PE=2 SV=1 174 510 2.0E-27
sp|P53742|NOG2_YEAST Nucleolar GTP-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOG2 PE=1 SV=1 174 485 2.0E-27
sp|Q6TGJ8|NOG2_CRYGA Nucleolar GTP-binding protein 2 OS=Cryptococcus gattii GN=NOG2 PE=3 SV=1 174 492 3.0E-27
sp|Q8MT06|GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster GN=Ns1 PE=1 SV=2 175 499 1.0E-26
sp|Q54KS4|GNL3_DICDI Guanine nucleotide-binding protein-like 3 homolog OS=Dictyostelium discoideum GN=gnl3 PE=3 SV=1 173 524 2.0E-26
sp|Q9NVN8|GNL3L_HUMAN Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens GN=GNL3L PE=1 SV=1 175 493 1.0E-24
sp|Q3T0J9|GNL3L_BOVIN Guanine nucleotide-binding protein-like 3-like protein OS=Bos taurus GN=GNL3L PE=2 SV=1 175 493 3.0E-24
sp|Q6PGG6|GNL3L_MOUSE Guanine nucleotide-binding protein-like 3-like protein OS=Mus musculus GN=Gnl3l PE=1 SV=1 175 492 5.0E-22
sp|Q7SHR8|NOG2_NEUCR Nucleolar GTP-binding protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nog-2 PE=3 SV=1 323 492 3.0E-19
sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 177 491 1.0E-16
sp|Q6DRP2|GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio GN=gnl3 PE=2 SV=1 175 382 4.0E-15
sp|Q58859|Y1464_METJA Uncharacterized GTP-binding protein MJ1464 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1464 PE=3 SV=1 328 485 4.0E-14
sp|Q8CI11|GNL3_MOUSE Guanine nucleotide-binding protein-like 3 OS=Mus musculus GN=Gnl3 PE=1 SV=2 176 504 6.0E-14
sp|Q9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens GN=GNL3 PE=1 SV=2 176 504 5.0E-12
sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 176 428 1.0E-11
sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 166 486 4.0E-11
sp|Q5RA07|GNL1_PONAB Guanine nucleotide-binding protein-like 1 OS=Pongo abelii GN=GNL1 PE=2 SV=1 122 242 4.0E-11
sp|Q7ZX41|GNL3_XENLA Guanine nucleotide-binding protein-like 3 OS=Xenopus laevis GN=gnl3 PE=2 SV=1 143 554 4.0E-11
sp|Q9WZM6|RBGA_THEMA Ribosome biogenesis GTPase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbgA PE=1 SV=1 328 484 4.0E-11
sp|Q4R8D2|GNL1_MACFA Guanine nucleotide-binding protein-like 1 OS=Macaca fascicularis GN=GNL1 PE=2 SV=1 122 242 5.0E-11
sp|Q5TM59|GNL1_MACMU Guanine nucleotide-binding protein-like 1 OS=Macaca mulatta GN=GNL1 PE=3 SV=1 122 242 5.0E-11
sp|Q6MG06|GNL1_RAT Guanine nucleotide-binding protein-like 1 OS=Rattus norvegicus GN=Gnl1 PE=1 SV=1 122 242 6.0E-11
sp|P36915|GNL1_HUMAN Guanine nucleotide-binding protein-like 1 OS=Homo sapiens GN=GNL1 PE=1 SV=2 122 242 6.0E-11
sp|Q7YR35|GNL1_PANTR Guanine nucleotide-binding protein-like 1 OS=Pan troglodytes GN=GNL1 PE=3 SV=3 122 242 6.0E-11
sp|Q8H1F6|DGP3_ARATH DAR GTPase 3, chloroplastic OS=Arabidopsis thaliana GN=DGP3 PE=2 SV=1 137 491 3.0E-10
sp|Q6P4W5|GNL3_XENTR Guanine nucleotide-binding protein-like 3 OS=Xenopus tropicalis GN=gnl3 PE=2 SV=2 175 494 6.0E-10
sp|Q811S9|GNL3_RAT Guanine nucleotide-binding protein-like 3 OS=Rattus norvegicus GN=Gnl3 PE=1 SV=1 334 504 4.0E-07
sp|A5N2K5|ENGB_CLOK5 Probable GTP-binding protein EngB OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=engB PE=3 SV=1 304 390 2.0E-06
sp|C3PMD9|ENGB_RICAE Probable GTP-binding protein EngB OS=Rickettsia africae (strain ESF-5) GN=engB PE=3 SV=1 328 385 4.0E-06
sp|Q92JC9|ENGB_RICCN Probable GTP-binding protein EngB OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=engB PE=3 SV=2 328 385 4.0E-06
sp|Q4UNC2|ENGB_RICFE Probable GTP-binding protein EngB OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=engB PE=3 SV=1 328 385 4.0E-06
sp|Q1RH06|ENGB_RICBR Probable GTP-binding protein EngB OS=Rickettsia bellii (strain RML369-C) GN=engB PE=3 SV=1 328 383 5.0E-06
sp|A8GUK6|ENGB_RICB8 Probable GTP-binding protein EngB OS=Rickettsia bellii (strain OSU 85-389) GN=engB PE=3 SV=1 328 383 5.0E-06
sp|A9BHV0|ENGB_PETMO Probable GTP-binding protein EngB OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=engB PE=3 SV=1 303 387 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4167
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4836 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3625
Ophiocordyceps camponoti-floridani Ophcf2|05068
Ophiocordyceps camponoti-rufipedis Ophun1|5226
Ophiocordyceps kimflemingae Ophio5|3630
Ophiocordyceps subramaniannii Hirsu2|8461

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4836
MPQPKSKKSVGLGNALMNDRFRKGNGGDRKRASAITRTNHTTGEQYLVNEKQDAAWVKMRSVTEQAPLDEFLATA
ELAGTDFTAEKMSNVKIIHTDQRNPHLLTAREEMHVLGKHGQYRARLTVPRRPRWDASTTPEQLDAQERESFLVW
RRGLAELQENNDLLMTPFERNLEVWRQLWRVIERSDLVVQIVDARNALLFRSADLESYVKDVDAQKENLLLINKA
DMMTLKQRRAWAKHLRQAGIAFKFFSAHLAKELNESSHDEATSQPSPKRLAKQPATQDALLQDDKDGSGGQDDED
TQILTVQELEDIFLQHAPSETGDGHKLQVGLVGYPNVGKSSTINALIGAKKVSVSATPGKTKHFQTIHLSDRVIL
CDCPGLVFPNFAFTKADLVCNGVLPIDQMREFTGPVGLVAQRIPQRFLEAVYGINIKTRPLEEGGTGVPTAQELL
RAYATARGFHTQGLGQPDEARAARYVLKDYVNGKLLFVHPPPGIDDAKAFNNELYDELHLPEKRRAALVASTHSL
SLDDATEASVAESDMVALPVGPKSKKLDEGFFNPVGAQGRISMPFNYKYTQQGSASGNSADKHLSGRKARTMVAL
ENGIDVKDVQVVASKKHFKGGPRNGKGKKHRSVALDD*
Coding >OphauG2|4836
ATGCCTCAGCCCAAATCCAAAAAGAGCGTTGGGCTCGGCAACGCCCTCATGAATGACCGCTTCCGCAAAGGCAAC
GGCGGCGACAGAAAACGAGCATCAGCCATTACCCGCACCAACCACACAACCGGCGAGCAATACCTGGTCAACGAG
AAACAAGATGCCGCCTGGGTCAAGATGCGCTCCGTCACCGAGCAAGCGCCTCTGGACGAATTCCTCGCCACGGCC
GAACTTGCCGGCACCGACTTTACGGCCGAGAAGATGAGCAACGTCAAGATTATCCACACGGACCAAAGAAACCCA
CATCTGCTTACTGCGCGCGAGGAAATGCATGTCTTGGGGAAACATGGCCAGTATCGAGCGCGCCTGACGGTGCCC
CGGAGACCTCGCTGGGATGCCTCCACCACTCCCGAGCAACTCGACGCCCAGGAACGCGAGAGCTTTCTCGTCTGG
CGGAGGGGCCTAGCTGAGTTGCAGGAGAACAACGACTTGCTCATGACGCCCTTTGAGCGCAACCTCGAGGTGTGG
CGCCAGCTGTGGCGCGTCATTGAGCGCTCCGACCTTGTCGTCCAGATTGTCGATGCCCGCAACGCCCTGCTCTTC
CGCTCTGCCGATCTCGAGTCCTACGTCAAGGATGTCGATGCTCAAAAGGAGAATCTGCTTCTCATCAACAAGGCA
GACATGATGACGCTCAAGCAGCGCAGAGCATGGGCCAAGCACCTGAGACAAGCAGGCATTGCCTTTAAATTCTTC
TCGGCGCATCTGGCAAAGGAGCTCAACGAATCAAGCCATGACGAAGCCACAAGTCAGCCATCACCCAAGAGGTTG
GCAAAGCAGCCGGCGACACAAGATGCCTTATTACAAGACGACAAAGACGGAAGCGGCGGCCAGGATGACGAGGAC
ACACAGATTCTAACCGTCCAAGAGCTGGAGGACATCTTTTTACAACATGCCCCCAGCGAAACCGGCGACGGCCAC
AAGCTGCAGGTCGGACTGGTCGGCTATCCCAACGTCGGCAAGTCATCCACCATCAATGCTCTTATTGGCGCCAAA
AAGGTCTCCGTTTCCGCAACGCCCGGCAAGACAAAACACTTTCAAACAATCCACCTGAGCGACCGCGTCATTCTT
TGCGACTGCCCTGGCCTCGTCTTTCCCAACTTTGCCTTTACAAAGGCCGACCTTGTCTGCAACGGTGTGCTGCCC
ATTGACCAGATGCGCGAGTTCACCGGCCCCGTCGGCCTTGTTGCCCAGCGTATCCCCCAGCGCTTCCTCGAGGCC
GTCTACGGCATCAACATCAAGACCCGCCCGCTCGAAGAGGGCGGCACTGGTGTTCCCACTGCCCAAGAGCTCCTT
CGTGCCTATGCCACTGCTCGTGGTTTCCACACCCAAGGTCTCGGACAACCTGACGAGGCTCGTGCTGCTCGATAT
GTGCTCAAAGATTACGTCAACGGCAAGCTTCTCTTTGTCCATCCCCCTCCAGGCATCGATGACGCCAAGGCCTTC
AACAACGAACTCTACGACGAGCTGCATCTGCCAGAGAAGCGTCGTGCAGCTCTCGTCGCCTCTACCCACTCCCTC
TCCCTCGACGACGCCACTGAAGCCTCTGTTGCTGAATCAGACATGGTGGCCCTCCCCGTCGGCCCAAAGTCAAAG
AAGCTCGACGAGGGCTTTTTCAATCCAGTTGGCGCACAGGGCCGGATCAGCATGCCATTCAACTACAAGTACACA
CAACAGGGCAGTGCATCAGGCAACTCAGCTGACAAGCACCTCTCTGGACGCAAAGCAAGAACAATGGTGGCTCTG
GAGAACGGAATAGACGTCAAAGATGTGCAAGTGGTGGCGAGCAAGAAGCACTTCAAGGGCGGTCCCAGGAACGGC
AAGGGCAAAAAGCATCGAAGCGTGGCTCTGGACGACTGA
Transcript >OphauG2|4836
ATGCCTCAGCCCAAATCCAAAAAGAGCGTTGGGCTCGGCAACGCCCTCATGAATGACCGCTTCCGCAAAGGCAAC
GGCGGCGACAGAAAACGAGCATCAGCCATTACCCGCACCAACCACACAACCGGCGAGCAATACCTGGTCAACGAG
AAACAAGATGCCGCCTGGGTCAAGATGCGCTCCGTCACCGAGCAAGCGCCTCTGGACGAATTCCTCGCCACGGCC
GAACTTGCCGGCACCGACTTTACGGCCGAGAAGATGAGCAACGTCAAGATTATCCACACGGACCAAAGAAACCCA
CATCTGCTTACTGCGCGCGAGGAAATGCATGTCTTGGGGAAACATGGCCAGTATCGAGCGCGCCTGACGGTGCCC
CGGAGACCTCGCTGGGATGCCTCCACCACTCCCGAGCAACTCGACGCCCAGGAACGCGAGAGCTTTCTCGTCTGG
CGGAGGGGCCTAGCTGAGTTGCAGGAGAACAACGACTTGCTCATGACGCCCTTTGAGCGCAACCTCGAGGTGTGG
CGCCAGCTGTGGCGCGTCATTGAGCGCTCCGACCTTGTCGTCCAGATTGTCGATGCCCGCAACGCCCTGCTCTTC
CGCTCTGCCGATCTCGAGTCCTACGTCAAGGATGTCGATGCTCAAAAGGAGAATCTGCTTCTCATCAACAAGGCA
GACATGATGACGCTCAAGCAGCGCAGAGCATGGGCCAAGCACCTGAGACAAGCAGGCATTGCCTTTAAATTCTTC
TCGGCGCATCTGGCAAAGGAGCTCAACGAATCAAGCCATGACGAAGCCACAAGTCAGCCATCACCCAAGAGGTTG
GCAAAGCAGCCGGCGACACAAGATGCCTTATTACAAGACGACAAAGACGGAAGCGGCGGCCAGGATGACGAGGAC
ACACAGATTCTAACCGTCCAAGAGCTGGAGGACATCTTTTTACAACATGCCCCCAGCGAAACCGGCGACGGCCAC
AAGCTGCAGGTCGGACTGGTCGGCTATCCCAACGTCGGCAAGTCATCCACCATCAATGCTCTTATTGGCGCCAAA
AAGGTCTCCGTTTCCGCAACGCCCGGCAAGACAAAACACTTTCAAACAATCCACCTGAGCGACCGCGTCATTCTT
TGCGACTGCCCTGGCCTCGTCTTTCCCAACTTTGCCTTTACAAAGGCCGACCTTGTCTGCAACGGTGTGCTGCCC
ATTGACCAGATGCGCGAGTTCACCGGCCCCGTCGGCCTTGTTGCCCAGCGTATCCCCCAGCGCTTCCTCGAGGCC
GTCTACGGCATCAACATCAAGACCCGCCCGCTCGAAGAGGGCGGCACTGGTGTTCCCACTGCCCAAGAGCTCCTT
CGTGCCTATGCCACTGCTCGTGGTTTCCACACCCAAGGTCTCGGACAACCTGACGAGGCTCGTGCTGCTCGATAT
GTGCTCAAAGATTACGTCAACGGCAAGCTTCTCTTTGTCCATCCCCCTCCAGGCATCGATGACGCCAAGGCCTTC
AACAACGAACTCTACGACGAGCTGCATCTGCCAGAGAAGCGTCGTGCAGCTCTCGTCGCCTCTACCCACTCCCTC
TCCCTCGACGACGCCACTGAAGCCTCTGTTGCTGAATCAGACATGGTGGCCCTCCCCGTCGGCCCAAAGTCAAAG
AAGCTCGACGAGGGCTTTTTCAATCCAGTTGGCGCACAGGGCCGGATCAGCATGCCATTCAACTACAAGTACACA
CAACAGGGCAGTGCATCAGGCAACTCAGCTGACAAGCACCTCTCTGGACGCAAAGCAAGAACAATGGTGGCTCTG
GAGAACGGAATAGACGTCAAAGATGTGCAAGTGGTGGCGAGCAAGAAGCACTTCAAGGGCGGTCCCAGGAACGGC
AAGGGCAAAAAGCATCGAAGCGTGGCTCTGGACGACTGA
Gene >OphauG2|4836
ATGCCTCAGCCCAAATCCAAAAAGAGCGTTGGGCTCGGCAACGCCCTCATGAATGACCGCTTCCGCAAAGGCAAC
GGCGGCGACAGAAAACGAGCATCAGCCATTACCCGCACCAACCACACAACCGGCGAGCAATACCTGGTCAACGAG
AAACAAGATGCCGCCTGGGTCAAGATGCGCTCCGTCACCGAGCAAGCGCCTCTGGACGAATTCCTCGCCACGGCC
GAACTTGCCGGCACCGACTTTACGGCCGAGAAGATGAGCAACGTCAAGATTATCCACACGGACCAAAGAAACCCA
CATCTGCTTACTGCGCGCGAGGAAATGCATGTCTTGGGGAAACATGGCCAGTATCGAGCGCGCCTGACGGTGCCC
CGGAGACCTCGCTGGGATGCCTCCACCACTCCCGAGCAACTCGACGCCCAGGAACGCGAGAGCTTTCTCGTCTGG
CGGAGGGGCCTAGCTGAGTTGCAGGAGAACAACGACTTGCTCATGACGCCCTTTGAGCGCAACCTCGAGGTGTGG
CGCCAGCTGTGGCGCGTCATTGAGCGCTCCGACCTTGTCGTCCAGATTGTCGATGCCCGCAACGCCCTGCTCTTC
CGCTCTGCCGATCTCGAGTCCTACGTCAAGGATGTCGATGCTCAAAAGGAGAATCTGCTTCTCATCAACAAGGCA
GACATGATGACGCTCAAGCAGCGCAGAGCATGGGCCAAGCACCTGAGACAAGCAGGCATTGCCTTTAAATTCTTC
TCGGCGCATCTGGCAAAGGAGCTCAACGAATCAAGCCATGACGAAGCCACAAGTCAGCCATCACCCAAGAGGTTG
GCAAAGCAGCCGGCGACACAAGATGCCTTATTACAAGACGACAAAGACGGAAGCGGCGGCCAGGATGACGAGGAC
ACACAGATTCTAACCGTCCAAGAGCTGGAGGACATCTTTTTACAACATGCCCCCAGCGAAACCGGTGAGACACAC
ATCTCCTTGCTCAAAAAACAAGACCAGACTAACATGCATCTCAGGCGACGGCCACAAGCTGCAGGTCGGACTGGT
CGGCTATCCCAACGTCGGCAAGTCATCCACCATCAATGCTCTTATTGGCGCCAAAAAGGTCTCCGTTTCCGCAAC
GCCCGGCAAGACAAAACACTTTCAAACAATCCACCTGAGCGACCGCGTCATTCTTTGCGACTGCCCTGGCCTCGT
CTTTCCCAACTTTGCCTTTACAAAGGCCGACCTTGTCTGCAACGGTGTGCTGCCCATTGACCAGATGCGCGAGTT
CACCGGCCCCGTCGGCCTTGTTGCCCAGCGTATCCCCCAGCGCTTCCTCGAGGCCGTCTACGGCATCAACATCAA
GACCCGCCCGCTCGAAGAGGGCGGCACTGGTGTTCCCACTGCCCAAGAGCTCCTTCGTGCCTATGCCACTGCTCG
TGGTTTCCACACCCAAGGTCTCGGACAACCTGACGAGGCTCGTGCTGCTCGATATGTGCTCAAAGATTACGTCAA
CGGCAAGCTTCTCTTTGTCCATCCCCCTCCAGGCATCGATGACGCCAAGGCCTTCAACAACGAACTCTACGACGA
GCTGCATCTGCCAGAGAAGCGTCGTGCAGCTCTCGTCGCCTCTACCCACTCCCTCTCCCTCGACGACGCCACTGA
AGCCTCTGTTGCTGAATCAGACATGGTGGCCCTCCCCGTCGGCCCAAAGTCAAAGAAGCTCGACGAGGGCTTTTT
CAATCCAGTTGGCGCACAGGGCCGGATCAGCATGCCATTCAACTACAAGTACACACAACAGGGCAGTGCATCAGG
CAACTCAGCTGACAAGCACCTCTCTGGACGCAAAGCAAGAACAATGGTGGCTCTGGAGAACGGAATAGACGTCAA
AGATGTGCAAGTGGTGGCGAGCAAGAAGCACTTCAAGGGCGGTCCCAGGAACGGCAAGGGCAAAAAGCATCGAAG
CGTGGCTCTGGACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail