Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4835
Gene name
LocationContig_418:1215..4169
Strand+
Gene length (bp)2954
Transcript length (bp)2676
Coding sequence length (bp)2676
Protein length (aa) 892

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.2E-50 510 717

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 258 280 22
2 293 315 22
3 703 725 22
4 738 760 22
5 780 802 22
6 832 854 22
7 864 886 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4835
MPSQRPLTSVSLPGDQSSGSRSGPSTPRNSSYDDGFRYRTIVSYLYNRVVASGWVPSESSRCHEDCSGVLLRRSR
SNYVTAPNPVHHDLLGAVVRLNLAVAVTMRPEMLDGILRSLVAGQTELKFKDGSQMQIIESLVLAHPASVKKFQY
ACLCRQERLILVWHDELHQIVPTATQLEEKLLTLVWGQDKLPFSILHMPSRDVSTYSSGISSPNGTTTPVLEKSG
PLAQITEFEQHADGDAAFERPESVLRPVILSSAFFVGLALALSICLLLGVYLGKLITDCVLDYSWTRLALAVPIP
LLMCVSLFFFQVIFSNLFQMIGPIGGMNTNSKFYSCHKPCLRRAYADGFQPPKITIQMPVYKEGMESVIIPTVRS
LQAAVSYYESHGGSANIFVNDDGLRAGLSDQDIEKRREFYHDNKIGWVSRPKHNGDEGFVRKGKFKKASNMNFGL
NISQKVEAYLQEIVDARVAEHGTDMIDEADEATMYEAALSRVLNENPLAWAEGDIRVGEIILLVDSDTRVPVDCL
LYGAAEMFLSPETAIVQHSTGVMQVSRDYFENGITFFTNLVYTSIRFSIASGEVAPFVGHNAFLRWQAVQDVART
SDSDYTAYWSESHVSEDFDMALHLQIKGNSVRVASYHNDEFKEGVSLTIYDEIARWQKYAYGVSEMIFHPFHRWI
FKGPFTPLFYTYLGSNIMLSSKLSILAYMCSYMALGSAVLLTIINYFLVGWFRDDLSSCYLTSWNVLLSLFVVFN
AAGPISLAILRYRAGDRSLLSSLGENIKWMPLMTVFFGGISFHVSLALLAHLFHVDMQWGATAKEKEDSNFFQEM
PRIFTTFRWMYLVIAMFVAVMIYLGAFAPPDWAITDFTVVVPLSLTLGFHALVPLVLNPSLMIFNY*
Coding >OphauG2|4835
ATGCCGAGTCAACGACCCCTCACAAGCGTCTCTTTGCCCGGTGATCAATCGAGTGGAAGCCGCTCAGGACCATCT
ACGCCACGGAACAGCAGCTACGACGATGGTTTTCGCTACCGGACAATTGTTAGCTATCTCTACAACAGAGTCGTA
GCCAGTGGATGGGTCCCTTCTGAGTCTTCCCGCTGCCATGAAGACTGTTCAGGGGTACTGCTGCGGCGCTCAAGG
AGCAACTATGTGACTGCTCCAAACCCCGTTCACCATGATCTACTGGGAGCCGTTGTGAGGCTAAATTTGGCCGTT
GCGGTGACTATGCGTCCTGAAATGCTTGACGGCATCTTGCGCTCCTTGGTTGCAGGCCAAACGGAGCTGAAATTC
AAAGACGGCTCGCAGATGCAGATTATTGAATCTTTAGTCTTGGCTCATCCTGCCAGCGTCAAGAAATTTCAGTAT
GCGTGTCTCTGTCGTCAAGAGCGACTGATCCTTGTCTGGCATGACGAACTGCATCAAATTGTCCCAACGGCGACT
CAACTGGAAGAGAAGCTTCTGACTCTGGTATGGGGCCAAGACAAGCTGCCATTTAGCATATTACACATGCCTAGT
CGCGACGTGTCTACCTATTCCTCTGGTATTTCGAGCCCCAATGGCACCACGACGCCAGTGCTTGAAAAGTCGGGC
CCTCTGGCTCAAATCACGGAATTTGAGCAACATGCAGATGGCGACGCAGCATTTGAGCGTCCAGAGTCTGTCCTA
AGGCCAGTGATCCTTTCCTCGGCCTTTTTCGTGGGACTTGCCCTGGCTCTGTCCATCTGCTTGCTGCTGGGCGTT
TACTTGGGCAAGCTAATCACGGATTGCGTGCTTGACTATTCGTGGACACGACTGGCCCTTGCTGTGCCTATACCA
CTTTTGATGTGCGTCAGCCTCTTCTTCTTTCAGGTGATTTTCAGCAATCTTTTTCAAATGATTGGGCCAATTGGC
GGTATGAACACCAATTCAAAGTTTTACTCGTGCCACAAGCCCTGTTTACGCCGAGCCTACGCCGATGGCTTTCAG
CCTCCCAAAATCACCATTCAGATGCCGGTCTACAAGGAAGGCATGGAGTCTGTCATTATTCCCACTGTGCGCAGC
CTCCAAGCCGCCGTGTCTTACTATGAGTCTCACGGGGGATCTGCAAACATCTTTGTCAACGACGATGGTCTCAGA
GCGGGGCTTTCTGACCAAGACATTGAGAAACGGCGAGAGTTTTACCACGATAACAAGATTGGCTGGGTGTCGCGG
CCCAAGCATAATGGCGACGAAGGGTTTGTGCGCAAAGGGAAATTCAAAAAGGCGTCCAACATGAACTTTGGGCTC
AACATATCTCAAAAGGTCGAGGCGTATCTTCAGGAAATTGTTGACGCCAGAGTCGCCGAGCACGGAACTGACATG
ATTGACGAGGCTGACGAAGCAACCATGTATGAGGCGGCCTTGTCTCGCGTCCTGAATGAGAATCCGCTGGCATGG
GCCGAAGGCGATATCCGAGTTGGCGAGATTATTTTGCTAGTCGACTCGGACACTCGTGTGCCTGTCGACTGTCTT
CTCTACGGAGCTGCGGAAATGTTTTTGTCGCCAGAGACTGCCATTGTTCAGCACTCGACGGGCGTGATGCAAGTC
TCGCGTGACTACTTTGAAAATGGCATCACCTTCTTCACAAACCTGGTGTACACGTCGATTCGGTTTTCGATTGCC
TCTGGTGAAGTAGCGCCATTTGTTGGGCACAATGCCTTTTTGAGATGGCAAGCGGTCCAAGATGTGGCGAGGACG
AGCGATTCAGACTATACTGCCTATTGGTCTGAAAGCCATGTTTCCGAAGACTTTGACATGGCGCTTCACTTGCAA
ATCAAGGGCAACAGCGTCCGCGTGGCCAGCTATCACAACGACGAGTTCAAGGAGGGCGTGTCGCTAACCATTTAC
GACGAGATTGCGCGCTGGCAAAAGTATGCCTATGGCGTCAGTGAAATGATATTCCACCCCTTTCACCGCTGGATC
TTCAAAGGCCCCTTTACGCCCCTCTTCTACACTTACCTGGGATCCAACATTATGCTCTCGTCCAAGCTGTCCATT
CTGGCATACATGTGCTCCTACATGGCCCTTGGCTCGGCCGTCTTGCTCACCATTATCAACTACTTCCTCGTCGGG
TGGTTCCGCGACGACTTGTCCTCGTGCTACCTGACTTCGTGGAACGTGCTCCTCTCTCTTTTTGTCGTCTTCAAC
GCTGCTGGACCCATCTCGCTGGCCATTTTGCGCTACCGTGCTGGGGACCGCTCCCTCTTGTCGTCACTGGGGGAG
AACATCAAGTGGATGCCGCTCATGACGGTTTTCTTTGGCGGCATCTCCTTCCACGTCAGTCTGGCACTGCTGGCC
CACTTGTTCCACGTCGACATGCAGTGGGGAGCAACAGCAAAGGAAAAGGAAGACAGCAACTTTTTCCAGGAAATG
CCTCGCATATTCACCACTTTTCGCTGGATGTATCTCGTCATTGCCATGTTTGTCGCCGTCATGATTTACTTGGGC
GCCTTTGCCCCTCCTGACTGGGCCATTACCGACTTTACGGTTGTTGTGCCACTATCGCTGACTCTGGGCTTCCAT
GCCTTGGTTCCCTTGGTACTAAACCCCAGCCTAATGATCTTCAACTACTGA
Transcript >OphauG2|4835
ATGCCGAGTCAACGACCCCTCACAAGCGTCTCTTTGCCCGGTGATCAATCGAGTGGAAGCCGCTCAGGACCATCT
ACGCCACGGAACAGCAGCTACGACGATGGTTTTCGCTACCGGACAATTGTTAGCTATCTCTACAACAGAGTCGTA
GCCAGTGGATGGGTCCCTTCTGAGTCTTCCCGCTGCCATGAAGACTGTTCAGGGGTACTGCTGCGGCGCTCAAGG
AGCAACTATGTGACTGCTCCAAACCCCGTTCACCATGATCTACTGGGAGCCGTTGTGAGGCTAAATTTGGCCGTT
GCGGTGACTATGCGTCCTGAAATGCTTGACGGCATCTTGCGCTCCTTGGTTGCAGGCCAAACGGAGCTGAAATTC
AAAGACGGCTCGCAGATGCAGATTATTGAATCTTTAGTCTTGGCTCATCCTGCCAGCGTCAAGAAATTTCAGTAT
GCGTGTCTCTGTCGTCAAGAGCGACTGATCCTTGTCTGGCATGACGAACTGCATCAAATTGTCCCAACGGCGACT
CAACTGGAAGAGAAGCTTCTGACTCTGGTATGGGGCCAAGACAAGCTGCCATTTAGCATATTACACATGCCTAGT
CGCGACGTGTCTACCTATTCCTCTGGTATTTCGAGCCCCAATGGCACCACGACGCCAGTGCTTGAAAAGTCGGGC
CCTCTGGCTCAAATCACGGAATTTGAGCAACATGCAGATGGCGACGCAGCATTTGAGCGTCCAGAGTCTGTCCTA
AGGCCAGTGATCCTTTCCTCGGCCTTTTTCGTGGGACTTGCCCTGGCTCTGTCCATCTGCTTGCTGCTGGGCGTT
TACTTGGGCAAGCTAATCACGGATTGCGTGCTTGACTATTCGTGGACACGACTGGCCCTTGCTGTGCCTATACCA
CTTTTGATGTGCGTCAGCCTCTTCTTCTTTCAGGTGATTTTCAGCAATCTTTTTCAAATGATTGGGCCAATTGGC
GGTATGAACACCAATTCAAAGTTTTACTCGTGCCACAAGCCCTGTTTACGCCGAGCCTACGCCGATGGCTTTCAG
CCTCCCAAAATCACCATTCAGATGCCGGTCTACAAGGAAGGCATGGAGTCTGTCATTATTCCCACTGTGCGCAGC
CTCCAAGCCGCCGTGTCTTACTATGAGTCTCACGGGGGATCTGCAAACATCTTTGTCAACGACGATGGTCTCAGA
GCGGGGCTTTCTGACCAAGACATTGAGAAACGGCGAGAGTTTTACCACGATAACAAGATTGGCTGGGTGTCGCGG
CCCAAGCATAATGGCGACGAAGGGTTTGTGCGCAAAGGGAAATTCAAAAAGGCGTCCAACATGAACTTTGGGCTC
AACATATCTCAAAAGGTCGAGGCGTATCTTCAGGAAATTGTTGACGCCAGAGTCGCCGAGCACGGAACTGACATG
ATTGACGAGGCTGACGAAGCAACCATGTATGAGGCGGCCTTGTCTCGCGTCCTGAATGAGAATCCGCTGGCATGG
GCCGAAGGCGATATCCGAGTTGGCGAGATTATTTTGCTAGTCGACTCGGACACTCGTGTGCCTGTCGACTGTCTT
CTCTACGGAGCTGCGGAAATGTTTTTGTCGCCAGAGACTGCCATTGTTCAGCACTCGACGGGCGTGATGCAAGTC
TCGCGTGACTACTTTGAAAATGGCATCACCTTCTTCACAAACCTGGTGTACACGTCGATTCGGTTTTCGATTGCC
TCTGGTGAAGTAGCGCCATTTGTTGGGCACAATGCCTTTTTGAGATGGCAAGCGGTCCAAGATGTGGCGAGGACG
AGCGATTCAGACTATACTGCCTATTGGTCTGAAAGCCATGTTTCCGAAGACTTTGACATGGCGCTTCACTTGCAA
ATCAAGGGCAACAGCGTCCGCGTGGCCAGCTATCACAACGACGAGTTCAAGGAGGGCGTGTCGCTAACCATTTAC
GACGAGATTGCGCGCTGGCAAAAGTATGCCTATGGCGTCAGTGAAATGATATTCCACCCCTTTCACCGCTGGATC
TTCAAAGGCCCCTTTACGCCCCTCTTCTACACTTACCTGGGATCCAACATTATGCTCTCGTCCAAGCTGTCCATT
CTGGCATACATGTGCTCCTACATGGCCCTTGGCTCGGCCGTCTTGCTCACCATTATCAACTACTTCCTCGTCGGG
TGGTTCCGCGACGACTTGTCCTCGTGCTACCTGACTTCGTGGAACGTGCTCCTCTCTCTTTTTGTCGTCTTCAAC
GCTGCTGGACCCATCTCGCTGGCCATTTTGCGCTACCGTGCTGGGGACCGCTCCCTCTTGTCGTCACTGGGGGAG
AACATCAAGTGGATGCCGCTCATGACGGTTTTCTTTGGCGGCATCTCCTTCCACGTCAGTCTGGCACTGCTGGCC
CACTTGTTCCACGTCGACATGCAGTGGGGAGCAACAGCAAAGGAAAAGGAAGACAGCAACTTTTTCCAGGAAATG
CCTCGCATATTCACCACTTTTCGCTGGATGTATCTCGTCATTGCCATGTTTGTCGCCGTCATGATTTACTTGGGC
GCCTTTGCCCCTCCTGACTGGGCCATTACCGACTTTACGGTTGTTGTGCCACTATCGCTGACTCTGGGCTTCCAT
GCCTTGGTTCCCTTGGTACTAAACCCCAGCCTAATGATCTTCAACTACTGA
Gene >OphauG2|4835
ATGCCGAGTCAACGACCCCTCACAAGCGTCTCTTTGCCCGGTGATCAATCGAGTGGAAGCCGCTCAGGACCATCT
ACGCCACGGAACAGCAGCTACGACGATGGTTTTCGCTACCGGACAGTAAGTGCACATTTATGCTGCTGCTACTCG
AGGTGCATACCTGATGGCTCTTGTAGATTGTTAGCTATCTCTACAACAGAGTCGTAGCCAGTGGATGGGTCCCTT
CTGAGTCTTCCCGCTGCCATGAAGACTGTTCAGGGGTACTGCTGCGGCGCTCAAGGAGCAACTATGTGACTGCTC
CAAACCCCGTTCACCATGATCTACTGGGAGCCGTTGTGAGGCTAAATTTGGCCGTTGCGGTGACTATGCGTCCTG
AAATGCTTGACGGCATCTTGCGCTCCTTGGTTGCAGGCCAAACGGAGCTGAAATTCAAAGACGGCTCGCAGATGC
AGATTATTGAATCTTTAGTCTTGGCTCATCCTGCCAGCGTCAAGAAATTTCAGTATGCGTGTCTCTGTCGTCAAG
AGCGACTGATCCTTGTCTGGCATGACGAACTGCATCAAATTGTCCCAACGGCGACTCAACTGGAAGAGAAGCTTC
TGACTCTGGTAATGATAGCCACCCTTATTTCTATACAACCCATCTTTGTTCATCTCGATGTGGGACTGACACAAG
GCATTGTAGGTATGGGGCCAAGACAAGCTGCCATTTAGCATATTACACATGCCTAGTCGCGACGTGTCTACCTAT
TCCTCTGGTATTTCGAGCCCCAATGGCACCACGACGCCAGTGCTTGAAAAGTCGGGCCCTCTGGCTCAAATCACG
GAATTTGAGCAACATGCAGATGGCGACGCAGCATTTGAGCGTCCAGAGTCTGTCCTAAGGCCAGTGATCCTTTCC
TCGGCCTTTTTCGTGGGACTTGCCCTGGCTCTGTCCATCTGCTTGCTGCTGGGCGTTTACTTGGGCAAGCTAATC
ACGGATTGCGTGCTTGACTATTCGTGGACACGACTGGCCCTTGCTGTGCCTATACCACTTTTGATGTGCGTCAGC
CTCTTCTTCTTTCAGGTGATTTTCAGCAATCTTTTTCAAATGATTGGGCCAATTGGCGGTATGAACACCAATTCA
AAGTTTTACTCGTGCCACAAGCCCTGTTTACGCCGAGCCTACGCCGATGGCTTTCAGCCTCCCAAAATCACCATT
CAGATGCCGGTCTACAAGGAAGGCATGGAGTCTGTCATTATTCCCACTGTGCGCAGCCTCCAAGCCGCCGTGTCT
TACTATGAGTCTCACGGGGGATCTGCAAACATCTTTGTCAACGACGATGGTCTCAGAGCGGGGCTTTCTGACCAA
GACATTGAGAAACGGCGAGAGTTTTACCACGATAACAAGATTGGCTGGGTGTCGCGGCCCAAGCATAATGGCGAC
GAAGGGTTTGTGCGCAAAGGGAAATTCAAAAAGGCGTCCAACATGAACTTTGGGCTCAACATATCTCAAAAGGTC
GAGGCGTATCTTCAGGAAATTGTTGACGCCAGAGTCGCCGAGCACGGAACTGACATGATTGACGAGGCTGACGAA
GCAACCATGTATGAGGCGGCCTTGTCTCGCGTCCTGAATGAGAATCCGCTGGCATGGGCCGAAGGCGATATCCGA
GTTGGCGAGATTATTTTGCTAGTCGACTCGGACACTCGTGTGGTGAGCAGTGGCCGGCGCGCTTCTCTGAGTTTG
TTGTTGGCAATGTTTGCTGATTATGGGCTTGAAAATCAGCCTGTCGACTGTCTTCTCTACGGAGCTGCGGAAATG
TTTTTGTCGCCAGAGACTGCCATTGTTCAGCACTCGACGGGCGTGATGCAAGTCTCGCGTGACTACTTTGAAAAT
GGCATCACCTTCTTCACAAACCTGGTGTACACGTCGATTCGGTTTTCGATTGCCTCTGGTGAAGTAGCGCCATTT
GTTGGGCACAATGCCTTTTTGAGATGGCAAGGTGCGTCTCGCATCATCTTGACTTGCTCCTTCATCTCGAGGGAG
GCATGAATACATGGGCTGACAATGTCGAAGCGGTCCAAGATGTGGCGAGGACGAGCGATTCAGACTATACTGCCT
ATTGGTCTGAAAGCCATGTTTCCGAAGACTTTGACATGGCGCTTCACTTGCAAATCAAGGGCAACAGCGTCCGCG
TGGCCAGCTATCACAACGACGAGTTCAAGGAGGGCGTGTCGCTAACCATTTACGACGAGATTGCGCGCTGGCAAA
AGTATGCCTATGGCGTCAGTGAAATGATATTCCACCCCTTTCACCGCTGGATCTTCAAAGGCCCCTTTACGCCCC
TCTTCTACACTTACCTGGGATCCAACATTATGCTCTCGTCCAAGCTGTCCATTCTGGCATACATGTGCTCCTACA
TGGCCCTTGGCTCGGCCGTCTTGCTCACCATTATCAACTACTTCCTCGTCGGGTGGTTCCGCGACGACTTGTCCT
CGTGCTACCTGACTTCGTGGAACGTGCTCCTCTCTCTTTTTGTCGTCTTCAACGCTGCTGGACCCATCTCGCTGG
CCATTTTGCGCTACCGTGCTGGGGACCGCTCCCTCTTGTCGTCACTGGGGGAGAACATCAAGTGGATGCCGCTCA
TGACGGTTTTCTTTGGCGGCATCTCCTTCCACGTCAGTCTGGCACTGCTGGCCCACTTGTTCCACGTCGACATGC
AGTGGGGAGCAACAGCAAAGGAAAAGGAAGACAGCAACTTTTTCCAGGAAATGCCTCGCATATTCACCACTTTTC
GCTGGATGTATCTCGTCATTGCCATGTTTGTCGCCGTCATGATTTACTTGGGCGCCTTTGCCCCTCCTGACTGGG
CCATTACCGACTTTACGGTTGTTGTGCCACTATCGCTGACTCTGGGCTTCCATGCCTTGGTTCCCTTGGTACTAA
ACCCCAGCCTAATGATCTTCAACTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail