Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4833
Gene name
LocationContig_417:12768..14917
Strand+
Gene length (bp)2149
Transcript length (bp)2016
Coding sequence length (bp)2016
Protein length (aa) 672

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 4.9E-43 405 550
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 1.5E-14 311 358
PF13716 CRAL_TRIO_2 Divergent CRAL/TRIO domain 3.3E-05 418 548

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 215 644 2.0E-110
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 210 643 4.0E-96
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 220 643 4.0E-79
sp|Q9HDZ5|YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.09 PE=3 SV=1 317 642 3.0E-56
sp|Q9UUC2|YGR1_SCHPO CRAL-TRIO domain-containing protein C365.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.01 PE=2 SV=1 318 650 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 215 644 2.0E-110
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 210 643 4.0E-96
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 220 643 4.0E-79
sp|Q9HDZ5|YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.09 PE=3 SV=1 317 642 3.0E-56
sp|Q9UUC2|YGR1_SCHPO CRAL-TRIO domain-containing protein C365.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.01 PE=2 SV=1 318 650 5.0E-24
sp|Q9CWP6|MSPD2_MOUSE Motile sperm domain-containing protein 2 OS=Mus musculus GN=Mospd2 PE=1 SV=2 406 558 1.0E-16
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 336 551 4.0E-16
sp|F4JVA9|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana GN=SFH2 PE=2 SV=1 331 544 4.0E-15
sp|Q8NHP6|MSPD2_HUMAN Motile sperm domain-containing protein 2 OS=Homo sapiens GN=MOSPD2 PE=1 SV=1 406 558 6.0E-15
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 336 531 1.0E-14
sp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 OS=Arabidopsis thaliana GN=SFH8 PE=2 SV=1 242 532 1.0E-14
sp|F4J7S8|SFH9_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH9 OS=Arabidopsis thaliana GN=SFH9 PE=2 SV=1 339 551 5.0E-14
sp|Q94A34|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH12 OS=Arabidopsis thaliana GN=SFH12 PE=2 SV=1 331 550 1.0E-13
sp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 OS=Arabidopsis thaliana GN=SFH6 PE=2 SV=1 329 550 3.0E-13
sp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana GN=SFH3 PE=2 SV=1 331 551 4.0E-13
sp|Q9SIW3|SFH7_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH7 OS=Arabidopsis thaliana GN=SFH7 PE=2 SV=2 331 544 5.0E-13
sp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 OS=Arabidopsis thaliana GN=SFH4 PE=2 SV=1 338 544 5.0E-13
sp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 OS=Arabidopsis thaliana GN=SFH10 PE=3 SV=1 331 550 8.0E-13
sp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana GN=SFH1 PE=2 SV=1 338 544 8.0E-13
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 336 535 1.0E-12
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 300 527 6.0E-12
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 336 526 7.0E-12
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 339 558 8.0E-12
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 336 526 9.0E-12
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 336 526 1.0E-11
sp|Q55CU8|RSC5_DICDI Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1 336 572 1.0E-11
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 305 544 3.0E-11
sp|Q8GXC6|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5 OS=Arabidopsis thaliana GN=SFH5 PE=2 SV=1 338 550 4.0E-11
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 300 527 4.0E-11
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 331 550 4.0E-11
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 299 519 5.0E-11
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 339 539 5.0E-11
sp|P53844|PDR17_YEAST Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR17 PE=1 SV=1 339 558 3.0E-10
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 339 539 1.0E-09
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 299 519 2.0E-09
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 336 514 1.0E-08
sp|Q56Z59|PATL3_ARATH Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 SV=2 316 544 4.0E-08
sp|P53860|PDR16_YEAST Phosphatidylinositol transfer protein PDR16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR16 PE=1 SV=1 339 528 6.0E-08
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 288 552 9.0E-08
sp|Q9UDX3|S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens GN=SEC14L4 PE=1 SV=1 336 550 2.0E-07
sp|O76054|S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens GN=SEC14L2 PE=1 SV=1 305 550 2.0E-06
sp|P58875|S14L2_BOVIN SEC14-like protein 2 OS=Bos taurus GN=SEC14L2 PE=1 SV=2 305 578 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5151
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4833 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4283
Ophiocordyceps camponoti-floridani Ophcf2|01778
Ophiocordyceps camponoti-rufipedis Ophun1|6346
Ophiocordyceps kimflemingae Ophio5|4978
Ophiocordyceps subramaniannii Hirsu2|3592

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4833
MEPSLLLLPRLSRLLLTGPSTCQSHACLSIGAGTSESHITTLTLTLTPPARTPTSRLAPTHAKPYAFCRTATAVP
DSNSPTSVLLHPRNPRHASSWPLHTPAVPQITPNATPLLQFFSRISSYGPGPQLVATVTPAPGSDRLNLKSSLAC
FHSLFVFASTLVVVLIALAASHHRNHTQDPTAVAAPSYPTPQQGQEPVDSQQSHIAMTLQKIPPGHVGNLTPEQE
DKLRKLWTATFKVCGVADPAPNGSAVSNAPAQQPAEELESPQKRRFSLFRWKTNESQSSNHSSTAGDSAKDVGDD
NDKHGQLKQYQKTLASQTPESIRETIWAMVKHDHPDALMLRFLRARKWDVEKALVMLVSATNWRHTEMHVDSAIM
NPGEAGAVRDEKDGTPEEKKLAGDFMAQSRMGKSFIHGTDKQGRPICVVRVRLHKPGAQSAESLEKYTVFIIETA
RLVLEPPADTATIIFDMTGFSLANMDYHPVKFMIQCFEANYPECLGTVLVHNAPWVFQGIWRIIRGWLDPVVAAK
VHFTNYRAGLEEFIAPSQIIKELEGDEDWEYKYVEPIEGENDAMKDTETRDRLLKTRSELYNQFEEATRAWIRSP
ESSEGKQAQKKRQEIATNLKKGYWDLDPYMRSRSLYDRQGYLKPGGQVNWYEKEVPPQANGNGVHAPSEAT*
Coding >OphauG2|4833
ATGGAGCCGTCTTTGCTCCTCCTTCCCCGCTTGTCTCGACTGCTGCTTACTGGGCCCTCGACCTGCCAATCGCAC
GCCTGCCTATCAATCGGCGCAGGAACGTCTGAGAGCCACATTACGACGCTCACGCTCACGCTCACGCCGCCCGCG
CGCACGCCCACCTCCCGCCTGGCTCCCACACATGCCAAACCATACGCCTTTTGCCGCACGGCTACCGCCGTCCCC
GACTCCAACTCCCCGACCTCCGTTCTCCTCCATCCCCGGAATCCTAGACACGCCTCTTCTTGGCCTTTACATACC
CCTGCCGTGCCCCAGATTACCCCAAACGCTACCCCCCTTTTACAATTCTTCAGCAGAATTTCTTCCTACGGCCCC
GGACCTCAGTTAGTTGCAACCGTTACTCCCGCCCCTGGCTCAGACCGCCTCAACCTTAAAAGCAGCCTGGCCTGC
TTCCACTCTCTATTCGTATTCGCCTCTACTCTTGTTGTTGTTCTTATTGCCTTGGCAGCATCCCACCACCGGAAT
CACACCCAGGACCCCACCGCCGTTGCCGCTCCTTCCTACCCGACACCTCAGCAAGGACAAGAACCAGTCGACAGC
CAACAATCCCACATCGCCATGACACTCCAGAAAATACCCCCCGGACATGTTGGCAATTTGACGCCTGAGCAGGAA
GACAAACTCCGCAAACTCTGGACCGCCACCTTCAAAGTCTGTGGCGTTGCAGACCCAGCCCCGAATGGCTCCGCC
GTCTCCAATGCTCCCGCTCAGCAACCTGCAGAAGAACTCGAGTCTCCCCAAAAGCGGCGCTTCAGTCTCTTTAGA
TGGAAGACAAACGAGAGCCAGTCGTCCAACCATAGTTCCACCGCCGGTGACTCCGCCAAAGACGTTGGAGATGAC
AACGACAAACACGGCCAACTCAAGCAGTATCAAAAGACCCTTGCTAGTCAGACCCCAGAGTCTATCCGAGAGACT
ATCTGGGCCATGGTCAAGCATGACCATCCTGACGCCCTAATGCTGCGCTTCCTGCGCGCACGCAAATGGGATGTG
GAAAAGGCCCTCGTCATGCTTGTCTCTGCTACCAACTGGAGACACACTGAAATGCATGTTGACTCGGCAATAATG
AACCCCGGTGAAGCCGGTGCTGTTCGCGACGAGAAGGATGGCACCCCTGAAGAGAAGAAGCTTGCAGGCGACTTT
ATGGCCCAGTCTCGCATGGGAAAGAGCTTCATTCACGGCACCGACAAGCAAGGTCGGCCCATCTGCGTCGTCAGG
GTCAGACTGCATAAGCCAGGTGCGCAGTCTGCCGAGAGTCTCGAGAAATATACCGTCTTCATCATCGAGACGGCT
CGCCTTGTCCTCGAGCCCCCTGCTGATACGGCTACCATTATTTTTGACATGACTGGCTTCTCGCTGGCTAATATG
GATTACCATCCTGTCAAATTCATGATTCAATGCTTCGAGGCCAACTACCCCGAGTGTCTTGGTACAGTTCTTGTT
CACAATGCACCCTGGGTATTTCAAGGGATCTGGAGAATTATTCGCGGCTGGCTTGACCCTGTCGTTGCCGCCAAG
GTACACTTCACAAATTATAGGGCTGGGCTGGAAGAATTCATAGCCCCCAGTCAAATAATTAAGGAGTTGGAAGGG
GACGAAGACTGGGAATACAAATACGTGGAGCCGATTGAGGGCGAAAACGACGCCATGAAAGATACAGAGACCAGG
GATCGGCTCCTCAAGACCAGGTCAGAACTTTACAATCAGTTTGAGGAGGCCACTCGAGCCTGGATTCGATCGCCC
GAATCCTCCGAGGGAAAACAGGCACAGAAGAAGCGCCAAGAGATTGCTACCAACCTTAAGAAAGGTTATTGGGAT
CTTGACCCTTACATGCGCTCAAGGTCCTTGTACGACAGACAAGGCTACCTGAAACCCGGCGGCCAGGTCAATTGG
TACGAAAAGGAAGTGCCGCCGCAAGCCAACGGGAACGGTGTCCACGCGCCATCCGAGGCAACATGA
Transcript >OphauG2|4833
ATGGAGCCGTCTTTGCTCCTCCTTCCCCGCTTGTCTCGACTGCTGCTTACTGGGCCCTCGACCTGCCAATCGCAC
GCCTGCCTATCAATCGGCGCAGGAACGTCTGAGAGCCACATTACGACGCTCACGCTCACGCTCACGCCGCCCGCG
CGCACGCCCACCTCCCGCCTGGCTCCCACACATGCCAAACCATACGCCTTTTGCCGCACGGCTACCGCCGTCCCC
GACTCCAACTCCCCGACCTCCGTTCTCCTCCATCCCCGGAATCCTAGACACGCCTCTTCTTGGCCTTTACATACC
CCTGCCGTGCCCCAGATTACCCCAAACGCTACCCCCCTTTTACAATTCTTCAGCAGAATTTCTTCCTACGGCCCC
GGACCTCAGTTAGTTGCAACCGTTACTCCCGCCCCTGGCTCAGACCGCCTCAACCTTAAAAGCAGCCTGGCCTGC
TTCCACTCTCTATTCGTATTCGCCTCTACTCTTGTTGTTGTTCTTATTGCCTTGGCAGCATCCCACCACCGGAAT
CACACCCAGGACCCCACCGCCGTTGCCGCTCCTTCCTACCCGACACCTCAGCAAGGACAAGAACCAGTCGACAGC
CAACAATCCCACATCGCCATGACACTCCAGAAAATACCCCCCGGACATGTTGGCAATTTGACGCCTGAGCAGGAA
GACAAACTCCGCAAACTCTGGACCGCCACCTTCAAAGTCTGTGGCGTTGCAGACCCAGCCCCGAATGGCTCCGCC
GTCTCCAATGCTCCCGCTCAGCAACCTGCAGAAGAACTCGAGTCTCCCCAAAAGCGGCGCTTCAGTCTCTTTAGA
TGGAAGACAAACGAGAGCCAGTCGTCCAACCATAGTTCCACCGCCGGTGACTCCGCCAAAGACGTTGGAGATGAC
AACGACAAACACGGCCAACTCAAGCAGTATCAAAAGACCCTTGCTAGTCAGACCCCAGAGTCTATCCGAGAGACT
ATCTGGGCCATGGTCAAGCATGACCATCCTGACGCCCTAATGCTGCGCTTCCTGCGCGCACGCAAATGGGATGTG
GAAAAGGCCCTCGTCATGCTTGTCTCTGCTACCAACTGGAGACACACTGAAATGCATGTTGACTCGGCAATAATG
AACCCCGGTGAAGCCGGTGCTGTTCGCGACGAGAAGGATGGCACCCCTGAAGAGAAGAAGCTTGCAGGCGACTTT
ATGGCCCAGTCTCGCATGGGAAAGAGCTTCATTCACGGCACCGACAAGCAAGGTCGGCCCATCTGCGTCGTCAGG
GTCAGACTGCATAAGCCAGGTGCGCAGTCTGCCGAGAGTCTCGAGAAATATACCGTCTTCATCATCGAGACGGCT
CGCCTTGTCCTCGAGCCCCCTGCTGATACGGCTACCATTATTTTTGACATGACTGGCTTCTCGCTGGCTAATATG
GATTACCATCCTGTCAAATTCATGATTCAATGCTTCGAGGCCAACTACCCCGAGTGTCTTGGTACAGTTCTTGTT
CACAATGCACCCTGGGTATTTCAAGGGATCTGGAGAATTATTCGCGGCTGGCTTGACCCTGTCGTTGCCGCCAAG
GTACACTTCACAAATTATAGGGCTGGGCTGGAAGAATTCATAGCCCCCAGTCAAATAATTAAGGAGTTGGAAGGG
GACGAAGACTGGGAATACAAATACGTGGAGCCGATTGAGGGCGAAAACGACGCCATGAAAGATACAGAGACCAGG
GATCGGCTCCTCAAGACCAGGTCAGAACTTTACAATCAGTTTGAGGAGGCCACTCGAGCCTGGATTCGATCGCCC
GAATCCTCCGAGGGAAAACAGGCACAGAAGAAGCGCCAAGAGATTGCTACCAACCTTAAGAAAGGTTATTGGGAT
CTTGACCCTTACATGCGCTCAAGGTCCTTGTACGACAGACAAGGCTACCTGAAACCCGGCGGCCAGGTCAATTGG
TACGAAAAGGAAGTGCCGCCGCAAGCCAACGGGAACGGTGTCCACGCGCCATCCGAGGCAACATGA
Gene >OphauG2|4833
ATGGAGCCGTCTTTGCTCCTCCTTCCCCGCTTGTCTCGACTGCTGCTTACTGGGCCCTCGACCTGCCAATCGCAC
GCCTGCCTATCAATCGGCGCAGGAACGTCTGAGAGCCACATTACGACGCTCACGCTCACGCTCACGCCGCCCGCG
CGCACGCCCACCTCCCGCCTGGCTCCCACACATGCCAAACCATACGCCTTTTGCCGCACGGCTACCGCCGTCCCC
GACTCCAACTCCCCGACCTCCGTTCTCCTCCATCCCCGGAATCCTAGACACGCCTCTTCTTGGCCTTTACATACC
CCTGCCGTGCCCCAGATTACCCCAAACGCTACCCCCCTTTTACAATTCTTCAGCAGAATTTCTTCCTACGGCCCC
GGACCTCAGTTAGTTGCAACCGTTACTCCCGCCCCTGGCTCAGACCGCCTCAACCTTAAAAGCAGCCTGGCCTGC
TTCCACTCTCTATTCGTATTCGCCTCTACTCTTGTTGTTGTTCTTATTGCCTTGGCAGCATCCCACCACCGGAAT
CACACCCAGGACCCCACCGCCGTTGCCGCTCCTTCCTACCCGACACCTCAGCAAGGACAAGAACCAGTCGACAGC
CAACAATCCCACATCGCCATGACACTCCAGAAAATACCCCCCGGACATGTTGGCAATTTGACGCCTGAGCAGGAA
GACAAACTCCGCAAACTCTGGACCGCCACCTTCAAAGTCTGTGGCGTTGCAGACCCAGCCCCGAATGGCTCCGCC
GTCTCCAATGCTCCCGCTCAGCAACCTGCAGAAGAACTCGAGTCTCCCCAAAAGCGGCGCTTCAGTCTCTTTAGA
TGGAAGACAAACGAGAGCCAGTCGTCCAACCATAGTTCCACCGCCGGTGACTCCGCCAAAGACGTTGGAGATGAC
AACGACAAACACGGCCAACTCAAGCAGTATCAAAAGACCCTTGCTAGTCAGACCCCAGAGTCTATCCGAGAGACT
ATCTGGGCCATGGTCAAGCATGACCATCCTGACGCCCTAATGCTGCGCTTCCTGCGCGCACGCAAATGGGATGTG
GAAAAGGCCCTCGTCATGCTTGTCTCTGCTACCAACTGGAGACACACTGAAATGCATGTTGACTCGGCAATAATG
AACCCCGGTGAAGCCGGTGCTGTTCGCGACGAGAAGGATGGCACCCCTGAAGAGAAGAAGCTTGCAGGCGACTTT
ATGGCCCAGTCTCGCATGGGAAAGAGCTTCATTCACGGCACCGACAAGCAAGGTCGGCCCATCTGCGTCGTCAGG
GTCAGACTGCATAAGCCAGGTGCGCAGTCTGCCGAGAGTCTCGAGAAATATACCGTCTTCATCATCGAGACGGCT
CGCCTTGTCCTCGAGCCCCCTGCTGATACGGCTGTACGCTTATTCTTCCCCCCAAGTCTTGCTATCACCATCAGT
CAGCTAACTAGCAATGCTTTGTTGTGGAGACCATTATTTTTGACATGACTGGCTTCTCGCTGGCTAATATGGATT
ACCATCCTGTCAAATTCATGATTCAATGCTTCGAGGCCAACTACCCCGAGTGTCTTGGTACAGTTCTTGTTCACA
ATGCACCCTGGGTATTTCAAGGTATGTACCGCAAAGGGGATTGGTGTGCTCCTATAATTTGTGACGTGCTCACCT
ACTTGTAGGGATCTGGAGAATTATTCGCGGCTGGCTTGACCCTGTCGTTGCCGCCAAGGTACACTTCACAAATTA
TAGGGCTGGGCTGGAAGAATTCATAGCCCCCAGTCAAATAATTAAGGAGTTGGAAGGGGACGAAGACTGGGAATA
CAAATACGTGGAGCCGATTGAGGGCGAAAACGACGCCATGAAAGATACAGAGACCAGGGATCGGCTCCTCAAGAC
CAGGTCAGAACTTTACAATCAGTTTGAGGAGGCCACTCGAGCCTGGATTCGATCGCCCGAATCCTCCGAGGGAAA
ACAGGCACAGAAGAAGCGCCAAGAGATTGCTACCAACCTTAAGAAAGGTTATTGGGATCTTGACCCTTACATGCG
CTCAAGGTCCTTGTACGACAGACAAGGCTACCTGAAACCCGGCGGCCAGGTCAATTGGTACGAAAAGGAAGTGCC
GCCGCAAGCCAACGGGAACGGTGTCCACGCGCCATCCGAGGCAACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail