Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4830
Gene name
LocationContig_417:5035..6580
Strand+
Gene length (bp)1545
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 2.0E-03 193 231
PF00571 CBS CBS domain 1.5E-05 260 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q874W3|SDS23_PODAS Protein SDS23 OS=Podospora anserina GN=SDS23 PE=3 SV=1 29 474 0.0E+00
sp|Q2HHB4|SDS23_CHAGB Protein SDS23 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SDS23 PE=3 SV=1 30 474 3.0E-176
sp|A4QRM8|SDS23_MAGO7 Protein SDS23 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SDS23 PE=3 SV=1 31 448 2.0E-161
sp|A7FA72|SDS23_BOTFB Protein sds23 OS=Botryotinia fuckeliana (strain B05.10) GN=sds23 PE=3 SV=1 11 469 3.0E-152
sp|A7F3V4|SDS23_SCLS1 Protein sds23 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sds23 PE=3 SV=1 22 469 8.0E-152
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q874W3|SDS23_PODAS Protein SDS23 OS=Podospora anserina GN=SDS23 PE=3 SV=1 29 474 0.0E+00
sp|Q2HHB4|SDS23_CHAGB Protein SDS23 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SDS23 PE=3 SV=1 30 474 3.0E-176
sp|A4QRM8|SDS23_MAGO7 Protein SDS23 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SDS23 PE=3 SV=1 31 448 2.0E-161
sp|A7FA72|SDS23_BOTFB Protein sds23 OS=Botryotinia fuckeliana (strain B05.10) GN=sds23 PE=3 SV=1 11 469 3.0E-152
sp|A7F3V4|SDS23_SCLS1 Protein sds23 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sds23 PE=3 SV=1 22 469 8.0E-152
sp|Q0U194|SDS23_PHANO Protein SDS23 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SDS23 PE=3 SV=1 30 447 6.0E-141
sp|A1CQZ4|SDS23_ASPCL Protein sds23 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sds23 PE=3 SV=1 8 447 7.0E-136
sp|A1D3V8|SDS23_NEOFI Protein sds23 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sds23 PE=3 SV=1 8 447 3.0E-129
sp|A2RB71|SDS23_ASPNC Protein sds23 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sds23 PE=3 SV=1 31 447 8.0E-123
sp|P38314|SDS24_YEAST Protein SDS24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS24 PE=1 SV=1 78 456 3.0E-68
sp|A6ZLF4|SDS24_YEAS7 Protein SDS24 OS=Saccharomyces cerevisiae (strain YJM789) GN=SDS24 PE=3 SV=1 78 456 3.0E-68
sp|A7TL18|SDS23_VANPO Protein SDS23 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SDS23 PE=3 SV=1 79 458 4.0E-68
sp|Q75EC0|SDS23_ASHGO Protein SDS23 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SDS23 PE=3 SV=1 74 456 6.0E-68
sp|Q6C5K4|SDS23_YARLI Protein SDS23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SDS23 PE=3 SV=1 79 445 1.0E-67
sp|Q6CUE1|SDS23_KLULA Protein SDS23 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SDS23 PE=3 SV=1 74 456 5.0E-67
sp|Q6FMN0|SDS23_CANGA Protein SDS23 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDS23 PE=3 SV=1 81 454 7.0E-66
sp|P53172|SDS23_YEAST Protein SDS23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS23 PE=1 SV=2 79 454 7.0E-62
sp|A5DNL9|SDS23_PICGU Protein SDS23 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SDS23 PE=3 SV=2 77 446 2.0E-59
sp|A6ZUC0|SDS23_YEAS7 Protein SDS23 OS=Saccharomyces cerevisiae (strain YJM789) GN=SDS23 PE=3 SV=1 79 376 2.0E-58
sp|A3LQC5|SDS23_PICST Protein SDS23 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SDS23 PE=3 SV=2 64 453 4.0E-57
sp|Q5A744|SDS23_CANAL Protein SDS23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SDS23 PE=2 SV=1 66 467 4.0E-56
sp|Q6BMN7|SDS23_DEBHA Protein SDS23 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SDS23 PE=3 SV=2 43 473 4.0E-55
sp|Q09826|SDS23_SCHPO Protein sds23/moc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds23 PE=1 SV=1 80 474 2.0E-53
sp|Q9MYP4|AAKG3_PIG 5'-AMP-activated protein kinase subunit gamma-3 OS=Sus scrofa GN=PRKAG3 PE=1 SV=2 176 369 3.0E-07
sp|Q9UGI9|AAKG3_HUMAN 5'-AMP-activated protein kinase subunit gamma-3 OS=Homo sapiens GN=PRKAG3 PE=1 SV=3 176 369 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4830
MDAPSSITSKDARPVKDKDASSMSSTARTAHRQTFADNLRNVPPSPRHRHPSLTQAAVQELLNHPPSGNRHVNSR
FAGREWRDVTIGELVSPRDVKWIDMDSSVEEATMMLLKSNTNVVLVRENFASIKATATFDYSDLNAYLLVVVGLS
RPDAQHIDLYNSIMAKGGQGLPISVREIQSLCKQEPLINMASTGNLSHAIEVLGSGIHRLLVTDSVGHVVGVLSQ
LRLVDFFWNEGVNFAMVDRLYPVALRDLAIGSQRTISVNSDAPLSDALVLMNNEGLTSIAVVDNGQNVVGNISSK
DVRHLTTASSARLLGESCMHFISVILNERGMEEGRDAFPVFYVSPYSTLAHAVAKLVATRSHRMWIVESASPSPS
APATPLIGPQSYANGAVVTSQAPTSPIPTAAVPASAMAGARLSGKLCGVVSLTDILNTFARFTGLHPTDPGEQRA
RRRRSSSSSMRPSLDSSRASLDIRW*
Coding >OphauG2|4830
ATGGATGCCCCGTCTAGCATCACCAGCAAGGATGCACGACCAGTCAAGGACAAGGATGCGTCGTCAATGAGCAGC
ACGGCCAGGACGGCACACCGACAAACCTTTGCTGACAATCTACGCAACGTTCCTCCTTCTCCGCGCCATCGTCAT
CCATCTCTGACCCAGGCCGCTGTTCAGGAGCTCCTCAACCATCCACCCTCGGGCAACAGACACGTCAACTCGCGC
TTTGCCGGCCGCGAGTGGCGAGATGTCACCATCGGCGAGCTAGTGTCTCCCCGCGATGTCAAGTGGATTGACATG
GACAGCAGTGTTGAAGAGGCTACCATGATGCTGCTCAAGAGCAATACAAATGTGGTACTTGTGCGCGAGAATTTT
GCCTCGATTAAAGCCACGGCGACCTTTGACTATAGTGACCTCAACGCTTACTTGCTTGTCGTTGTCGGCTTGTCG
AGGCCTGATGCCCAGCACATTGACCTGTACAATAGTATAATGGCCAAGGGCGGACAAGGGCTTCCTATTTCAGTT
CGTGAGATACAGTCACTGTGTAAACAGGAGCCGCTTATCAACATGGCATCCACTGGGAACCTCTCTCATGCCATC
GAAGTTCTGGGCAGCGGCATTCATCGACTATTGGTCACTGACTCGGTCGGACATGTCGTCGGCGTTCTCAGCCAA
TTGAGACTGGTTGATTTCTTCTGGAACGAGGGCGTCAACTTTGCCATGGTAGATCGGCTATATCCAGTTGCCCTA
CGAGACTTGGCCATTGGATCTCAGCGCACCATTTCTGTCAACTCCGATGCTCCCCTTTCAGACGCGCTAGTCCTC
ATGAATAATGAGGGCTTGACAAGTATTGCCGTCGTGGATAATGGGCAGAATGTTGTGGGAAATATCTCGTCCAAG
GACGTACGACATCTGACAACAGCATCCAGTGCAAGGCTTCTTGGCGAGTCTTGTATGCACTTCATCTCTGTTATA
CTCAATGAGAGAGGCATGGAGGAGGGACGAGATGCGTTTCCCGTTTTCTACGTCAGCCCATACTCAACACTGGCT
CATGCAGTAGCCAAACTGGTAGCCACGAGGTCCCATCGCATGTGGATTGTCGAGTCGGCATCACCGTCACCCTCA
GCTCCTGCAACGCCGCTCATCGGTCCACAGAGCTATGCAAATGGTGCTGTGGTCACGAGTCAAGCTCCTACGTCA
CCTATTCCCACAGCAGCTGTGCCAGCCTCGGCCATGGCAGGCGCACGACTATCGGGCAAGCTATGTGGCGTAGTA
TCACTAACGGATATTCTCAACACCTTTGCTCGCTTTACGGGACTGCATCCAACAGATCCAGGAGAACAGCGGGCC
AGAAGACGGCGAAGCTCGAGCAGTTCGATGCGTCCAAGCCTCGACTCGTCACGGGCTAGTCTAGATATTCGGTGG
TGA
Transcript >OphauG2|4830
ATGGATGCCCCGTCTAGCATCACCAGCAAGGATGCACGACCAGTCAAGGACAAGGATGCGTCGTCAATGAGCAGC
ACGGCCAGGACGGCACACCGACAAACCTTTGCTGACAATCTACGCAACGTTCCTCCTTCTCCGCGCCATCGTCAT
CCATCTCTGACCCAGGCCGCTGTTCAGGAGCTCCTCAACCATCCACCCTCGGGCAACAGACACGTCAACTCGCGC
TTTGCCGGCCGCGAGTGGCGAGATGTCACCATCGGCGAGCTAGTGTCTCCCCGCGATGTCAAGTGGATTGACATG
GACAGCAGTGTTGAAGAGGCTACCATGATGCTGCTCAAGAGCAATACAAATGTGGTACTTGTGCGCGAGAATTTT
GCCTCGATTAAAGCCACGGCGACCTTTGACTATAGTGACCTCAACGCTTACTTGCTTGTCGTTGTCGGCTTGTCG
AGGCCTGATGCCCAGCACATTGACCTGTACAATAGTATAATGGCCAAGGGCGGACAAGGGCTTCCTATTTCAGTT
CGTGAGATACAGTCACTGTGTAAACAGGAGCCGCTTATCAACATGGCATCCACTGGGAACCTCTCTCATGCCATC
GAAGTTCTGGGCAGCGGCATTCATCGACTATTGGTCACTGACTCGGTCGGACATGTCGTCGGCGTTCTCAGCCAA
TTGAGACTGGTTGATTTCTTCTGGAACGAGGGCGTCAACTTTGCCATGGTAGATCGGCTATATCCAGTTGCCCTA
CGAGACTTGGCCATTGGATCTCAGCGCACCATTTCTGTCAACTCCGATGCTCCCCTTTCAGACGCGCTAGTCCTC
ATGAATAATGAGGGCTTGACAAGTATTGCCGTCGTGGATAATGGGCAGAATGTTGTGGGAAATATCTCGTCCAAG
GACGTACGACATCTGACAACAGCATCCAGTGCAAGGCTTCTTGGCGAGTCTTGTATGCACTTCATCTCTGTTATA
CTCAATGAGAGAGGCATGGAGGAGGGACGAGATGCGTTTCCCGTTTTCTACGTCAGCCCATACTCAACACTGGCT
CATGCAGTAGCCAAACTGGTAGCCACGAGGTCCCATCGCATGTGGATTGTCGAGTCGGCATCACCGTCACCCTCA
GCTCCTGCAACGCCGCTCATCGGTCCACAGAGCTATGCAAATGGTGCTGTGGTCACGAGTCAAGCTCCTACGTCA
CCTATTCCCACAGCAGCTGTGCCAGCCTCGGCCATGGCAGGCGCACGACTATCGGGCAAGCTATGTGGCGTAGTA
TCACTAACGGATATTCTCAACACCTTTGCTCGCTTTACGGGACTGCATCCAACAGATCCAGGAGAACAGCGGGCC
AGAAGACGGCGAAGCTCGAGCAGTTCGATGCGTCCAAGCCTCGACTCGTCACGGGCTAGTCTAGATATTCGGTGG
TGA
Gene >OphauG2|4830
ATGGATGCCCCGTCTAGCATCACCAGCAAGGATGCACGACCAGTCAAGGACAAGGATGCGTCGTCAATGAGCAGC
ACGGCCAGGACGGCACACCGACAAACCTTTGCTGACAATCTACGCAACGTTCCTCCTTCTCCGCGCCATCGTCAT
CCATCTCTGACCCAGGCCGCTGTTCAGGAGCTCCTCAACCATCCACCCTCGGGCAACAGACACGTCAACTCGCGC
TTTGCCGGCCGCGAGTGGCGAGATGTCACCATCGGCGAGCTAGTGTCTCCCCGCGATGTCAAGTGGATTGACATG
GACAGCAGTGTTGAAGAGGCTACCATGGTGAGAGGGGGGAGCCTTGTCGGTATCTTGGTGGCTAATTTGGAATCA
GATGCTGCTCAAGAGCAATACAAATGTGGTACTTGTGCGCGAGAATTTTGCCTCGATTAAAGCCACGGCGACCTT
TGACTATAGTGACCTCAACGCTTACTTGCTTGTCGTTGTCGGCTTGTCGAGGCCTGATGCCCAGCACATTGACCT
GTACAATAGTATAATGGCCAAGGGCGGACAAGGGCTTCCTATTTCAGTTCGTGAGATACAGTCACTGTGTAAACA
GGAGCCGCTTATCAACATGGCATCCACTGGGAACCTCTCTCATGCCATCGAAGTTCTGGGCAGCGGCATTCATCG
ACTATTGGTCACTGACTCGGTCGGACATGTCGTCGGCGTTCTCAGCCAATTGAGACTGGTTGATTTCTTCTGGAA
CGAGGGCGTCAACTTTGCCATGGTAGATCGGCTATATCCAGTTGCCCTACGAGACTTGGCCATTGGATCTCAGCG
CACCATTTCTGTCAAGTAAGTGTGTGCTGCCAACTGGCTTGCGACGGCCGAGAAAGGACTGATGGGCTGAAATTA
CCTCATAGCTCCGATGCTCCCCTTTCAGACGCGCTAGTCCTCATGAATAATGAGGGCTTGACAAGTATTGCCGTC
GTGGATAATGGGCAGAATGTTGTGGGAAATATCTCGTCCAAGGACGTACGACATCTGACAACAGCATCCAGTGCA
AGGCTTCTTGGCGAGTCTTGTATGCACTTCATCTCTGTTATACTCAATGAGAGAGGCATGGAGGAGGGACGAGAT
GCGTTTCCCGTTTTCTACGTCAGCCCATACTCAACACTGGCTCATGCAGTAGCCAAACTGGTAGCCACGAGGTCC
CATCGCATGTGGATTGTCGAGTCGGCATCACCGTCACCCTCAGCTCCTGCAACGCCGCTCATCGGTCCACAGAGC
TATGCAAATGGTGCTGTGGTCACGAGTCAAGCTCCTACGTCACCTATTCCCACAGCAGCTGTGCCAGCCTCGGCC
ATGGCAGGCGCACGACTATCGGGCAAGCTATGTGGCGTAGTATCACTAACGGATATTCTCAACACCTTTGCTCGC
TTTACGGGACTGCATCCAACAGATCCAGGAGAACAGCGGGCCAGAAGACGGCGAAGCTCGAGCAGTTCGATGCGT
CCAAGCCTCGACTCGTCACGGGCTAGTCTAGATATTCGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail