Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4829
Gene name
LocationContig_417:751..4369
Strand-
Gene length (bp)3618
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18829 Importin_rep_6 Importin repeat 6 5.7E-38 769 879
PF18808 Importin_rep_4 Importin repeat 3.8E-32 275 367
PF18816 Importin_rep_5 Importin repeat 2.4E-23 1011 1062
PF13513 HEAT_EZ HEAT-like repeat 2.9E-10 383 437
PF02985 HEAT HEAT repeat 1.8E-03 411 438
PF12460 MMS19_C RNAPII transcription regulator C-terminal 1.0E-08 454 566

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 4 1095 0.0E+00
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 1 1069 0.0E+00
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 15 1091 0.0E+00
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 15 1091 0.0E+00
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 11 1071 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 4 1095 0.0E+00
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 1 1069 0.0E+00
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 15 1091 0.0E+00
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 15 1091 0.0E+00
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 11 1071 0.0E+00
sp|O60518|RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens GN=RANBP6 PE=1 SV=2 11 1074 0.0E+00
sp|Q54EW3|IPO5_DICDI Probable importin-5 homolog OS=Dictyostelium discoideum GN=DDB_G0291650 PE=3 SV=1 12 1067 2.0E-84
sp|P40069|IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP123 PE=1 SV=1 8 632 9.0E-23
sp|O60100|IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap123 PE=3 SV=1 4 1068 7.0E-21
sp|Q8H0U4|TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana GN=TRN1 PE=1 SV=1 89 571 1.0E-15
sp|B8ARW2|TNPO1_ORYSI Transportin-1 OS=Oryza sativa subsp. indica GN=OsI_18044 PE=2 SV=1 88 571 2.0E-14
sp|B9FDR3|TNPO1_ORYSJ Transportin-1 OS=Oryza sativa subsp. japonica GN=TRN1 PE=3 SV=2 88 571 2.0E-14
sp|Q9FJD4|IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana GN=KPNB1 PE=1 SV=1 11 578 5.0E-08
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 333 544 4.0E-06
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 374 540 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4829
MSLLSANFHAELSQLLEALQSADNVVRSQAEEHLQSNWTSPRPDLLLMGLAEQIQAAQQNTTRSFAAVIFRRISS
KTRKLESGDAVDTFSSLSQEQAVAIRQKLLETLASEPERAVRNKISDAVAEVARQYVDNNDSWPELLSALFQLSQ
APEAEKRENAFRIFATTPSIIQSQHEEAVLQAFQRGFKDDSVMVRLAAMDAFAAFFKSIGKKSQLKYYALIPDVL
NILPPIKESQESDDLSKALVALIDLAETAPKMFKPLFHNLVQFSISVIQEKELDSICRQNALELMATFADYAPSM
CKKDSSYTTDMITQCLSLMTDLGEDDEDAAEWLASDDLEQDESDQNHVAGEQTMDRLANKLGGQVILAPTFNWLP
RMMTSMAWRDRHAALMAISAISEGCRDLMIGELNQVLDLVIPALQDPHPRVRWAGCNALGQMSTDFAPKMQTEHY
DRVLTTIIPVLSSPEARVKSHAAAALVNFCEEAEKTVLEPYLDNLLSHLFQLLQSDQRFVQEQALSTIATVADAA
EAAFSKYYDTLMPLLVSVLQNQTEKEYRLLRAKAMECSTLIALAVGRERLGGDALTLVKLLANIQTSITEADDPQ
SQYLMHSWGRMCRVLGTDFMPFLDDVMLPLLRLATARADIQLLEDEDQAEQMNSEDGWEFVPLKGKVIGIRTSTM
DDKHMAIELLVVYASVLEGAFAPYVANIMDKVALPGLAFFFHDPVRYMSSKLVPHLLISYKKAYGCPSNELTGLW
NATVDKLLEVLTAEPSIETLAEMYQCFYESVQVVGKGCLTPEHMSRFIDSASSAIEDYKDRVSQRTDEKEAATAD
DAEDEADELLVAIEDDQTLLSDMNKAFHAIFKHHGETFLPAWERLMPTYQAFLGSSDAMQRQWGLCIMDDVLEYC
GPESSRYAEVITQPLIDGCRDASPAIRQAAAYGIGVAAHRGGVPWSQFVGGSVPFMLQMTQVPNARDEENIYATE
NACAALAKVLHYSPSSIGDVQGTISQWIDTLPVTNDEEAAPYAYAYLTELIDQRHPLVMNQASKLFVLVAKALEA
ETIQGQTASRVVTALKALLTSANVDPTPLLQQFSQTSQRTIMGYFS*
Coding >OphauG2|4829
ATGTCTTTGCTTTCCGCCAATTTTCATGCTGAGCTGTCCCAGCTCCTTGAAGCACTTCAGTCCGCCGACAACGTT
GTGCGGTCACAGGCCGAGGAGCACCTACAATCCAACTGGACCAGCCCTCGACCCGACCTTCTCTTGATGGGACTC
GCCGAGCAAATTCAGGCTGCACAACAAAATACTACACGCTCCTTTGCTGCAGTCATATTTCGCAGAATTTCATCC
AAGACGAGAAAACTCGAATCAGGAGACGCTGTCGACACCTTTTCTTCCTTGTCTCAAGAACAAGCCGTGGCGATT
CGTCAAAAGTTGCTAGAAACCCTTGCATCCGAGCCCGAGCGCGCTGTTCGCAACAAAATTAGCGACGCCGTTGCA
GAGGTTGCGCGGCAGTATGTTGACAATAATGATTCTTGGCCAGAACTTCTCAGTGCACTTTTCCAGCTCAGCCAG
GCTCCAGAAGCCGAGAAGCGGGAAAATGCATTTAGGATTTTTGCCACAACGCCCAGCATTATTCAAAGTCAGCAT
GAAGAGGCTGTTCTACAAGCCTTCCAAAGGGGGTTCAAGGACGATTCCGTCATGGTTCGTCTTGCCGCTATGGAC
GCCTTTGCTGCCTTCTTTAAGTCGATCGGAAAGAAATCTCAGTTGAAATACTATGCCCTCATTCCCGATGTTCTT
AACATCTTGCCGCCCATCAAGGAATCACAAGAGTCAGATGATTTGAGCAAGGCTCTCGTGGCCCTCATTGACCTC
GCCGAGACGGCGCCCAAGATGTTCAAGCCGCTATTCCATAACCTTGTTCAATTTAGTATATCCGTCATTCAGGAG
AAGGAACTCGACAGCATTTGCAGGCAGAACGCTCTTGAGCTCATGGCCACCTTTGCTGATTATGCACCATCAATG
TGCAAGAAGGACTCCTCCTACACAACAGACATGATTACCCAATGCCTCAGCCTCATGACTGACTTGGGAGAGGAC
GACGAAGATGCTGCCGAATGGCTGGCGTCGGATGATCTTGAACAGGACGAAAGTGATCAGAACCACGTAGCCGGG
GAGCAAACCATGGATCGACTAGCCAACAAGCTTGGGGGCCAGGTCATTCTAGCTCCAACCTTCAACTGGTTACCT
AGAATGATGACCTCGATGGCGTGGAGAGACCGGCATGCTGCGTTAATGGCTATTTCCGCCATCTCAGAAGGCTGC
CGCGATCTTATGATTGGAGAGCTCAATCAAGTACTTGATTTGGTTATTCCGGCTCTGCAGGATCCACACCCTCGC
GTGCGATGGGCCGGCTGCAATGCTTTGGGGCAGATGAGTACCGATTTTGCCCCCAAAATGCAGACCGAACATTAT
GATCGAGTCCTTACGACCATCATTCCTGTGCTCAGCTCTCCAGAAGCTAGAGTCAAGTCCCACGCTGCGGCAGCA
TTGGTCAACTTTTGCGAGGAGGCTGAAAAGACGGTTTTGGAACCCTACTTGGACAATCTTTTGTCTCATCTCTTC
CAGCTACTTCAGAGCGACCAGAGATTTGTGCAAGAACAGGCTTTGTCCACCATTGCAACAGTGGCAGATGCGGCC
GAGGCCGCCTTTTCCAAGTACTACGATACTCTCATGCCGCTCCTCGTAAGTGTGCTGCAAAACCAAACAGAAAAG
GAGTATAGGCTATTGCGCGCCAAGGCTATGGAATGTTCGACCCTCATAGCCTTGGCTGTTGGACGTGAGCGTCTT
GGAGGTGATGCCTTGACATTGGTCAAGCTTCTTGCAAACATTCAGACATCTATTACAGAAGCAGATGATCCCCAG
TCACAGTATCTTATGCATAGCTGGGGCCGGATGTGCCGTGTTCTTGGCACTGATTTCATGCCTTTCTTGGATGAT
GTCATGCTGCCTCTCCTCCGGTTAGCCACGGCCAGGGCTGACATTCAGCTACTGGAAGACGAGGACCAGGCTGAA
CAAATGAATAGTGAAGACGGCTGGGAGTTTGTCCCACTCAAGGGCAAGGTGATTGGCATTCGCACAAGCACAATG
GACGACAAACATATGGCTATAGAGCTACTTGTTGTATACGCCTCTGTCCTCGAAGGCGCCTTTGCCCCGTACGTG
GCCAATATCATGGACAAGGTTGCACTGCCAGGTCTCGCTTTCTTTTTCCACGACCCTGTTCGCTACATGTCGTCA
AAACTTGTGCCGCATCTGCTCATTTCGTATAAAAAGGCATACGGTTGCCCTTCTAACGAACTTACTGGTCTCTGG
AATGCAACCGTCGACAAACTCTTGGAAGTACTTACGGCTGAGCCATCAATCGAAACTTTGGCCGAGATGTATCAA
TGCTTTTATGAGTCCGTTCAAGTTGTTGGCAAGGGTTGCTTGACCCCTGAGCACATGTCGCGCTTCATTGATTCG
GCCAGCTCAGCGATCGAAGACTATAAAGATAGAGTTTCTCAACGCACCGACGAAAAAGAGGCCGCCACGGCTGAT
GATGCTGAGGATGAGGCTGATGAACTGTTAGTGGCCATTGAGGATGACCAAACACTTCTCTCAGACATGAACAAG
GCGTTTCATGCCATCTTCAAGCACCACGGAGAGACTTTTCTGCCCGCATGGGAACGGCTAATGCCCACATATCAG
GCCTTCCTTGGCTCCTCGGATGCCATGCAGAGGCAATGGGGTCTGTGCATCATGGACGACGTGCTGGAATACTGC
GGTCCAGAAAGCAGTCGATATGCAGAAGTCATAACTCAACCTCTTATAGACGGCTGCAGAGACGCGTCGCCGGCA
ATTCGGCAAGCGGCCGCCTATGGAATAGGAGTAGCTGCTCATCGGGGCGGAGTGCCGTGGTCTCAGTTTGTCGGA
GGTTCCGTACCATTCATGCTACAGATGACTCAGGTGCCTAACGCGAGGGATGAAGAGAATATTTATGCCACGGAA
AATGCCTGTGCTGCCCTGGCTAAAGTTCTGCATTATAGTCCTTCCAGCATTGGGGATGTACAAGGGACAATTTCC
CAGTGGATTGATACGCTACCAGTGACCAACGACGAAGAAGCGGCACCATACGCATACGCGTATTTGACAGAGCTC
ATTGATCAGCGCCATCCTCTTGTCATGAACCAGGCTAGTAAGCTGTTTGTCTTGGTGGCTAAAGCTTTGGAGGCG
GAGACTATTCAAGGGCAGACGGCAAGTCGGGTGGTGACAGCACTGAAAGCGCTGCTCACATCTGCAAATGTTGAC
CCAACTCCTCTACTCCAACAGTTCTCGCAGACGTCGCAACGGACGATAATGGGATACTTTAGTTAA
Transcript >OphauG2|4829
ATGTCTTTGCTTTCCGCCAATTTTCATGCTGAGCTGTCCCAGCTCCTTGAAGCACTTCAGTCCGCCGACAACGTT
GTGCGGTCACAGGCCGAGGAGCACCTACAATCCAACTGGACCAGCCCTCGACCCGACCTTCTCTTGATGGGACTC
GCCGAGCAAATTCAGGCTGCACAACAAAATACTACACGCTCCTTTGCTGCAGTCATATTTCGCAGAATTTCATCC
AAGACGAGAAAACTCGAATCAGGAGACGCTGTCGACACCTTTTCTTCCTTGTCTCAAGAACAAGCCGTGGCGATT
CGTCAAAAGTTGCTAGAAACCCTTGCATCCGAGCCCGAGCGCGCTGTTCGCAACAAAATTAGCGACGCCGTTGCA
GAGGTTGCGCGGCAGTATGTTGACAATAATGATTCTTGGCCAGAACTTCTCAGTGCACTTTTCCAGCTCAGCCAG
GCTCCAGAAGCCGAGAAGCGGGAAAATGCATTTAGGATTTTTGCCACAACGCCCAGCATTATTCAAAGTCAGCAT
GAAGAGGCTGTTCTACAAGCCTTCCAAAGGGGGTTCAAGGACGATTCCGTCATGGTTCGTCTTGCCGCTATGGAC
GCCTTTGCTGCCTTCTTTAAGTCGATCGGAAAGAAATCTCAGTTGAAATACTATGCCCTCATTCCCGATGTTCTT
AACATCTTGCCGCCCATCAAGGAATCACAAGAGTCAGATGATTTGAGCAAGGCTCTCGTGGCCCTCATTGACCTC
GCCGAGACGGCGCCCAAGATGTTCAAGCCGCTATTCCATAACCTTGTTCAATTTAGTATATCCGTCATTCAGGAG
AAGGAACTCGACAGCATTTGCAGGCAGAACGCTCTTGAGCTCATGGCCACCTTTGCTGATTATGCACCATCAATG
TGCAAGAAGGACTCCTCCTACACAACAGACATGATTACCCAATGCCTCAGCCTCATGACTGACTTGGGAGAGGAC
GACGAAGATGCTGCCGAATGGCTGGCGTCGGATGATCTTGAACAGGACGAAAGTGATCAGAACCACGTAGCCGGG
GAGCAAACCATGGATCGACTAGCCAACAAGCTTGGGGGCCAGGTCATTCTAGCTCCAACCTTCAACTGGTTACCT
AGAATGATGACCTCGATGGCGTGGAGAGACCGGCATGCTGCGTTAATGGCTATTTCCGCCATCTCAGAAGGCTGC
CGCGATCTTATGATTGGAGAGCTCAATCAAGTACTTGATTTGGTTATTCCGGCTCTGCAGGATCCACACCCTCGC
GTGCGATGGGCCGGCTGCAATGCTTTGGGGCAGATGAGTACCGATTTTGCCCCCAAAATGCAGACCGAACATTAT
GATCGAGTCCTTACGACCATCATTCCTGTGCTCAGCTCTCCAGAAGCTAGAGTCAAGTCCCACGCTGCGGCAGCA
TTGGTCAACTTTTGCGAGGAGGCTGAAAAGACGGTTTTGGAACCCTACTTGGACAATCTTTTGTCTCATCTCTTC
CAGCTACTTCAGAGCGACCAGAGATTTGTGCAAGAACAGGCTTTGTCCACCATTGCAACAGTGGCAGATGCGGCC
GAGGCCGCCTTTTCCAAGTACTACGATACTCTCATGCCGCTCCTCGTAAGTGTGCTGCAAAACCAAACAGAAAAG
GAGTATAGGCTATTGCGCGCCAAGGCTATGGAATGTTCGACCCTCATAGCCTTGGCTGTTGGACGTGAGCGTCTT
GGAGGTGATGCCTTGACATTGGTCAAGCTTCTTGCAAACATTCAGACATCTATTACAGAAGCAGATGATCCCCAG
TCACAGTATCTTATGCATAGCTGGGGCCGGATGTGCCGTGTTCTTGGCACTGATTTCATGCCTTTCTTGGATGAT
GTCATGCTGCCTCTCCTCCGGTTAGCCACGGCCAGGGCTGACATTCAGCTACTGGAAGACGAGGACCAGGCTGAA
CAAATGAATAGTGAAGACGGCTGGGAGTTTGTCCCACTCAAGGGCAAGGTGATTGGCATTCGCACAAGCACAATG
GACGACAAACATATGGCTATAGAGCTACTTGTTGTATACGCCTCTGTCCTCGAAGGCGCCTTTGCCCCGTACGTG
GCCAATATCATGGACAAGGTTGCACTGCCAGGTCTCGCTTTCTTTTTCCACGACCCTGTTCGCTACATGTCGTCA
AAACTTGTGCCGCATCTGCTCATTTCGTATAAAAAGGCATACGGTTGCCCTTCTAACGAACTTACTGGTCTCTGG
AATGCAACCGTCGACAAACTCTTGGAAGTACTTACGGCTGAGCCATCAATCGAAACTTTGGCCGAGATGTATCAA
TGCTTTTATGAGTCCGTTCAAGTTGTTGGCAAGGGTTGCTTGACCCCTGAGCACATGTCGCGCTTCATTGATTCG
GCCAGCTCAGCGATCGAAGACTATAAAGATAGAGTTTCTCAACGCACCGACGAAAAAGAGGCCGCCACGGCTGAT
GATGCTGAGGATGAGGCTGATGAACTGTTAGTGGCCATTGAGGATGACCAAACACTTCTCTCAGACATGAACAAG
GCGTTTCATGCCATCTTCAAGCACCACGGAGAGACTTTTCTGCCCGCATGGGAACGGCTAATGCCCACATATCAG
GCCTTCCTTGGCTCCTCGGATGCCATGCAGAGGCAATGGGGTCTGTGCATCATGGACGACGTGCTGGAATACTGC
GGTCCAGAAAGCAGTCGATATGCAGAAGTCATAACTCAACCTCTTATAGACGGCTGCAGAGACGCGTCGCCGGCA
ATTCGGCAAGCGGCCGCCTATGGAATAGGAGTAGCTGCTCATCGGGGCGGAGTGCCGTGGTCTCAGTTTGTCGGA
GGTTCCGTACCATTCATGCTACAGATGACTCAGGTGCCTAACGCGAGGGATGAAGAGAATATTTATGCCACGGAA
AATGCCTGTGCTGCCCTGGCTAAAGTTCTGCATTATAGTCCTTCCAGCATTGGGGATGTACAAGGGACAATTTCC
CAGTGGATTGATACGCTACCAGTGACCAACGACGAAGAAGCGGCACCATACGCATACGCGTATTTGACAGAGCTC
ATTGATCAGCGCCATCCTCTTGTCATGAACCAGGCTAGTAAGCTGTTTGTCTTGGTGGCTAAAGCTTTGGAGGCG
GAGACTATTCAAGGGCAGACGGCAAGTCGGGTGGTGACAGCACTGAAAGCGCTGCTCACATCTGCAAATGTTGAC
CCAACTCCTCTACTCCAACAGTTCTCGCAGACGTCGCAACGGACGATAATGGGATACTTTAGTTAA
Gene >OphauG2|4829
ATGTCTTTGCTTTCCGCCAATTTTCATGCTGAGCTGTCCCAGCTCCTTGAAGCACTTCAGTCCGCCGACAACGTT
GTGCGGTCACAGGCCGAGGAGCACCTACAATCCAACTGGACCAGCCCTCGACCCGACCTTCTCTTGATGGGACTC
GCCGAGCAAATTCAGGCTGCACAACAAAATACTGTTTGTCCTCTATCCTCTATCCACTGCTCTGGCTATAGTGTC
AAGGCCTCTACTCACTGCTCTCATCAACAGACACGCTCCTTTGCTGCAGTCATATTTCGCAGAATTTCATCCAAG
ACGAGAAAACTCGAATCAGGAGACGCTGTCGACACCTTTTCTTCCTTGTCTCAAGAACAAGCCGTGGCGATTCGT
CAAAAGTTGCTAGAAACCCTTGCATCCGAGCCCGAGCGCGCTGTTCGCAACAAAATTAGCGACGCCGTTGCAGAG
GTTGCGCGGCAGTATGTTGACAATAGTCAGTAAACAGTCATCAAGCCTATTCGTCTACCTGCTAATAAGCAGCCT
GTTTTTCAAGATGATTCTTGGCCAGAACTTCTCAGTGCACTTTTCCAGCTCAGCCAGGCTCCAGAAGCCGAGAAG
CGGGAAAATGCATTTAGGATTTTTGCCACAACGCCCAGCATTATTCAAAGTCAGCATGAAGAGGCTGTTCTACAA
GCCTTCCAAAGGGGGTTCAAGGACGATTCCGTCATGGTACCATCCCGACCCTAGAGGGCCCTTGGACTCCGCTAA
CATGGCCCAGGTTCGTCTTGCCGCTATGGACGCCTTTGCTGCCTTCTTTAAGTCGATCGGAAAGAAATCTCAGTT
GAAATACTATGCCCTCATTCCCGATGTTCTTAACATCTTGCCGCCCATCAAGGAATCACAAGAGTCAGATGATTT
GAGCAAGGCTCTCGTGGCCCTCATTGACCTCGCCGAGACGGCGCCCAAGATGTTCAAGCCGCTATTCCATAACCT
TGTTCAATTTAGTATATCCGTCATTCAGGAGAAGGAACTCGACAGCATTTGCAGGCAGAACGCTCTTGAGCTCAT
GGCCACCTTTGCTGATTATGCACCATCAATGTGCAAGAAGGACTCCTCCTACACAACAGACATGATTACCCAATG
CCTCAGCCTCATGACTGACTTGGGAGAGGACGACGAAGATGCTGCCGAATGGCTGGCGTCGGATGATGTGAGTCA
AGCTTCCTATCACTTGCTCCCACCTCTTTTCGTGTGGCAAGCCTCTGCAACCAACTAACGAGATGTGGCAGCTTG
AACAGGACGAAAGTGATCAGAACCACGTAGCCGGGGAGCAAACCATGGATCGACTAGCCAACAAGCTTGGGGGCC
AGGTCATTCTAGCTCCAACCTTCAACTGGTTACCTAGAATGATGACCTCGATGGCGTGGAGAGACCGGCATGCTG
CGTTAATGGCTATTTCCGCCATCTCAGAAGGCTGCCGCGATCTTATGATTGGAGAGCTCAATCAAGTACTTGATT
TGGTTATTCCGGCTCTGCAGGATCCACACCCTCGCGTGCGATGGGCCGGCTGCAATGCTTTGGGGCAGATGAGTA
CCGATTTTGCCCCCAAAATGCAGACCGAACATTATGATCGAGTCCTTACGACCATCATTCCTGTGCTCAGCTCTC
CAGAAGCTAGAGTCAAGTCCCACGCTGCGGCAGCATTGGTCAACTTTTGCGAGGAGGCTGAAAAGACGGTTTTGG
AACCCTACTTGGACAATCTTTTGTCTCATCTCTTCCAGCTACTTCAGAGCGACCAGAGATTTGTGCAAGAACAGG
CTTTGTCCACCATTGCAACAGTGGCAGATGCGGCCGAGGCCGCCTTTTCCAAGTACTACGATACTCTCATGCCGC
TCCTCGTAAGTGTGCTGCAAAACCAAACAGAAAAGGAGTATAGGCTATTGCGCGCCAAGGCTATGGAATGTTCGA
CCCTCATAGCCTTGGCTGTTGGACGTGAGCGTCTTGGAGGTGATGCCTTGACATTGGTCAAGCTTCTTGCAAACA
TTCAGACATCTATTACAGAAGCAGATGATCCCCAGTCACAGTATCTTATGCATAGCTGGGGCCGGATGTGCCGTG
TTCTTGGCACTGATTTCATGCCTTTCTTGGATGATGTCATGCTGCCTCTCCTCCGGTTAGCCACGGCCAGGGCTG
ACATTCAGCTACTGGAAGACGAGGACCAGGCTGAACAAATGAATAGTGAAGACGGCTGGGAGTTTGTCCCACTCA
AGGGCAAGGTGATTGGCATTCGCACAAGCACAATGGACGACAAACATATGGCTATAGAGCTACTTGTTGTATACG
CCTCTGTCCTCGAAGGCGCCTTTGCCCCGTACGTGGCCAATATCATGGACAAGGTTGCACTGCCAGGTCTCGCTT
TCTTTTTCCACGACCCTGTTCGCTACATGTCGTCAAAACTTGTGCCGCATCTGCTCATTTCGTATAAAAAGGCAT
ACGGTTGCCCTTCTAACGAACTTACTGGTCTCTGGAATGCAACCGTCGACAAACTCTTGGAAGTACTTACGGCTG
AGCCATCAATCGAAACTTTGGCCGAGATGTATCAATGCTTTTATGAGTCCGTTCAAGTTGTTGGCAAGGGTTGCT
TGACCCCTGAGCACATGTCGCGCTTCATTGATTCGGCCAGCTCAGCGATCGAAGACTATAAAGATAGAGTTTCTC
AACGCACCGACGAAAAAGAGGCCGCCACGGCTGATGATGCTGAGGATGAGGCTGATGAACTGTTAGTGGCCATTG
AGGATGACCAAACACTTCTCTCAGACATGAACAAGGCGTTTCATGCCATCTTCAAGCACCACGGAGAGACTTTTC
TGCCCGCATGGGAACGGCTAATGCCCACATATCAGGCCTTCCTTGGCTCCTCGGATGCCATGCAGAGGCAATGGG
GTCTGTGCATCATGGACGACGTGCTGGAATACTGCGGTCCAGAAAGCAGTCGATATGCAGAAGTCATAACTCAAC
CTCTTATAGACGGCTGCAGAGACGCGTCGCCGGCAATTCGGCAAGCGGCCGCCTATGGAATAGGAGTAGCTGCTC
ATCGGGGCGGAGTGCCGTGGTCTCAGTTTGTCGGAGGTTCCGTACCATTCATGCTACAGATGACTCAGGTGCCTA
ACGCGAGGGATGAAGAGAATATTTATGCCACGGAAAATGCCTGTGCTGCCCTGGCTAAAGTTCTGCATTATAGTC
CTTCCAGCATTGGGGATGTACAAGGGACAATTTCCCAGTGGATTGATACGCTACCAGTGACCAACGACGAAGAAG
CGGCACCATACGCATACGCGTATTTGACAGAGCTCATTGATCAGTAAGTCGTAGCACCGGACCCCATTTGAGTAG
GCCACGATGTACATAAGCTGACAGCGTTGCTACAGGCGCCATCCTCTTGTCATGAACCAGGCTAGTAAGCTGTTT
GTCTTGGTGGCTAAAGCTTTGGAGGCGGAGACTATTCAAGGGCAGACGGCAAGTCGGGTGGTGACAGCACTGAAA
GCGCTGCTCACATCTGCAAATGTTGACCCAACTCCTCTACTCCAACAGTTCTCGCAGACGTCGCAACGGACGATA
ATGGGATACTTTAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail