Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4828
Gene name
LocationContig_416:14165..15386
Strand+
Gene length (bp)1221
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain 3.5E-71 157 314
PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain 4.2E-38 4 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZN0|G3P_SORMA Glyceraldehyde-3-phosphate dehydrogenase OS=Sordaria macrospora GN=GPD PE=3 SV=2 4 338 0.0E+00
sp|P54118|G3P_NEUCR Glyceraldehyde-3-phosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpd-1 PE=2 SV=2 4 338 0.0E+00
sp|Q00584|G3P_CLAP2 Glyceraldehyde-3-phosphate dehydrogenase OS=Claviceps purpurea (strain 20.1) GN=GPD-1 PE=3 SV=1 4 338 0.0E+00
sp|P35143|G3P_COLGL Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum gloeosporioides GN=GPDA PE=2 SV=1 1 338 0.0E+00
sp|P17730|G3P2_TRIKO Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Trichoderma koningii GN=gpd2 PE=1 SV=3 1 338 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZN0|G3P_SORMA Glyceraldehyde-3-phosphate dehydrogenase OS=Sordaria macrospora GN=GPD PE=3 SV=2 4 338 0.0E+00
sp|P54118|G3P_NEUCR Glyceraldehyde-3-phosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpd-1 PE=2 SV=2 4 338 0.0E+00
sp|Q00584|G3P_CLAP2 Glyceraldehyde-3-phosphate dehydrogenase OS=Claviceps purpurea (strain 20.1) GN=GPD-1 PE=3 SV=1 4 338 0.0E+00
sp|P35143|G3P_COLGL Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum gloeosporioides GN=GPDA PE=2 SV=1 1 338 0.0E+00
sp|P17730|G3P2_TRIKO Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Trichoderma koningii GN=gpd2 PE=1 SV=3 1 338 0.0E+00
sp|P54117|G3P_COLLN Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum lindemuthianum GN=GPDA PE=3 SV=1 1 338 0.0E+00
sp|P32637|G3P_PODAS Glyceraldehyde-3-phosphate dehydrogenase OS=Podospora anserina GN=GPD PE=3 SV=1 4 336 0.0E+00
sp|P19089|G3P_CRYPA Glyceraldehyde-3-phosphate dehydrogenase OS=Cryphonectria parasitica PE=3 SV=1 4 335 0.0E+00
sp|Q9P8C0|G3P_PHANO Glyceraldehyde-3-phosphate dehydrogenase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GPD1 PE=3 SV=1 4 335 0.0E+00
sp|Q96US8|G3P_SCLSC Glyceraldehyde-3-phosphate dehydrogenase OS=Sclerotinia sclerotiorum GN=GPD PE=3 SV=1 1 335 0.0E+00
sp|P28844|G3P_COCLU Glyceraldehyde-3-phosphate dehydrogenase OS=Cochliobolus lunatus GN=GPD PE=3 SV=1 4 335 0.0E+00
sp|Q1DTF9|G3P_COCIM Glyceraldehyde-3-phosphate dehydrogenase OS=Coccidioides immitis (strain RS) GN=GPD PE=3 SV=1 4 338 0.0E+00
sp|Q9HFX1|G3P_AJECA Glyceraldehyde-3-phosphate dehydrogenase OS=Ajellomyces capsulatus GN=GPD PE=2 SV=1 4 338 0.0E+00
sp|Q8J1H3|G3P_COCP7 Glyceraldehyde-3-phosphate dehydrogenase OS=Coccidioides posadasii (strain C735) GN=GPD PE=3 SV=1 4 338 0.0E+00
sp|P29497|G3P_COCHE Glyceraldehyde-3-phosphate dehydrogenase OS=Cochliobolus heterostrophus GN=GPD1 PE=3 SV=1 4 335 0.0E+00
sp|P87197|G3P_HYPAT Glyceraldehyde-3-phosphate dehydrogenase OS=Hypocrea atroviridis GN=gpd1 PE=2 SV=1 4 338 0.0E+00
sp|P53430|G3P_MONPU Glyceraldehyde-3-phosphate dehydrogenase OS=Monascus purpureus GN=GPD1 PE=3 SV=3 5 336 0.0E+00
sp|Q00640|G3P_BLUGH Glyceraldehyde-3-phosphate dehydrogenase OS=Blumeria graminis f. sp. hordei GN=GPD PE=3 SV=1 1 338 0.0E+00
sp|Q8X1X3|G3P_PARBA Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GPD PE=1 SV=1 4 338 0.0E+00
sp|P20445|G3P_EMENI Glyceraldehyde-3-phosphate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpdA PE=1 SV=2 1 336 0.0E+00
sp|Q12552|G3P_ASPNG Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus niger GN=gpdA PE=3 SV=2 1 336 0.0E+00
sp|P17729|G3P1_TRIKO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Trichoderma koningii GN=gpd1 PE=1 SV=3 1 338 0.0E+00
sp|Q9HGY7|G3P_ASPOR Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpdA PE=2 SV=1 1 335 0.0E+00
sp|P32636|G3P2_AGABI Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agaricus bisporus GN=gpd2 PE=3 SV=1 4 336 4.0E-177
sp|P09317|G3P_USTMA Glyceraldehyde-3-phosphate dehydrogenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GAPD PE=3 SV=2 1 336 5.0E-177
sp|P0CN74|G3P_CRYNJ Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GPD PE=3 SV=1 4 336 3.0E-175
sp|P0CN75|G3P_CRYNB Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GPD PE=3 SV=1 4 336 3.0E-175
sp|Q8NK47|G3P_RHIMI Glyceraldehyde-3-phosphate dehydrogenase OS=Rhizomucor miehei GN=GPD PE=3 SV=1 4 335 5.0E-175
sp|Q9Y796|G3P_CRYCU Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus curvatus GN=GPD PE=3 SV=1 5 335 8.0E-174
sp|Q5R2J2|G3P_PELSI Glyceraldehyde-3-phosphate dehydrogenase OS=Pelodiscus sinensis GN=GAPDH PE=2 SV=1 4 335 2.0E-173
sp|Q9UR38|G3P_LENED Glyceraldehyde-3-phosphate dehydrogenase OS=Lentinula edodes GN=gpd PE=2 SV=1 4 335 4.0E-173
sp|Q92211|G3P_CANAW Glyceraldehyde-3-phosphate dehydrogenase OS=Candida albicans (strain WO-1) GN=TDH1 PE=3 SV=2 4 336 2.0E-172
sp|P16858|G3P_MOUSE Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus GN=Gapdh PE=1 SV=2 4 335 2.0E-172
sp|Q5RAB4|G3P_PONAB Glyceraldehyde-3-phosphate dehydrogenase OS=Pongo abelii GN=GAPDH PE=2 SV=3 1 335 2.0E-172
sp|Q05025|G3P_COTJA Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix coturnix japonica GN=GAPDH PE=2 SV=2 4 335 2.0E-172
sp|P04797|G3P_RAT Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus norvegicus GN=Gapdh PE=1 SV=3 4 335 7.0E-172
sp|Q9SAJ6|G3PP1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic OS=Arabidopsis thaliana GN=GAPCP1 PE=1 SV=1 5 332 7.0E-172
sp|Q4KYY3|G3P_SPECI Glyceraldehyde-3-phosphate dehydrogenase OS=Spermophilus citellus GN=GAPDH PE=2 SV=3 4 335 9.0E-172
sp|P17244|G3P_CRIGR Glyceraldehyde-3-phosphate dehydrogenase OS=Cricetulus griseus GN=GAPDH PE=2 SV=2 4 335 9.0E-172
sp|P00356|G3P_CHICK Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus gallus GN=GAPDH PE=2 SV=3 4 335 3.0E-171
sp|O13507|G3P_PHARH Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffia rhodozyma GN=GPD PE=3 SV=1 4 336 3.0E-171
sp|P04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 1 335 3.0E-171
sp|O57479|G3P_COLLI Glyceraldehyde-3-phosphate dehydrogenase OS=Columba livia GN=GAPDH PE=2 SV=3 4 335 3.0E-171
sp|Q9N2D5|G3P_FELCA Glyceraldehyde-3-phosphate dehydrogenase OS=Felis catus GN=GAPDH PE=2 SV=3 4 335 4.0E-171
sp|A3FKF7|G3P_MUSPF Glyceraldehyde-3-phosphate dehydrogenase OS=Mustela putorius furo GN=GAPDH PE=2 SV=1 4 335 8.0E-171
sp|Q5XJ10|G3P_DANRE Glyceraldehyde-3-phosphate dehydrogenase OS=Danio rerio GN=gapdh PE=2 SV=2 4 335 8.0E-171
sp|Q5E924|G3PP2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic OS=Arabidopsis thaliana GN=GAPCP2 PE=2 SV=1 5 338 1.0E-170
sp|P46406|G3P_RABIT Glyceraldehyde-3-phosphate dehydrogenase OS=Oryctolagus cuniculus GN=GAPDH PE=1 SV=3 4 335 2.0E-170
sp|Q28259|G3P_CANLF Glyceraldehyde-3-phosphate dehydrogenase OS=Canis lupus familiaris GN=GAPDH PE=2 SV=3 4 335 4.0E-170
sp|P00355|G3P_PIG Glyceraldehyde-3-phosphate dehydrogenase OS=Sus scrofa GN=GAPDH PE=1 SV=4 4 335 5.0E-170
sp|P10096|G3P_BOVIN Glyceraldehyde-3-phosphate dehydrogenase OS=Bos taurus GN=GAPDH PE=1 SV=4 4 335 6.0E-170
sp|Q6BMK0|G3P_DEBHA Glyceraldehyde-3-phosphate dehydrogenase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPD PE=3 SV=1 4 333 1.0E-169
sp|Q4U3L0|G3P_GLOMM Glyceraldehyde-3-phosphate dehydrogenase OS=Glossina morsitans morsitans GN=Gapdh PE=2 SV=1 5 336 2.0E-169
sp|Q6CCU7|G3P_YARLI Glyceraldehyde-3-phosphate dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPD PE=3 SV=1 4 336 3.0E-169
sp|P20287|G3P_SCHMA Glyceraldehyde-3-phosphate dehydrogenase OS=Schistosoma mansoni PE=2 SV=1 1 335 2.0E-168
sp|Q8TFJ2|G3P_OMPOL Glyceraldehyde-3-phosphate dehydrogenase OS=Omphalotus olearius GN=GPD PE=3 SV=1 4 335 3.0E-168
sp|P48812|G3P_BRUMA Glyceraldehyde-3-phosphate dehydrogenase OS=Brugia malayi GN=G3PD PE=1 SV=1 1 332 6.0E-167
sp|P78958|G3P1_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tdh1 PE=1 SV=1 1 335 7.0E-167
sp|P25861|G3PC_ANTMA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1 1 332 8.0E-167
sp|P51469|G3P_XENLA Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopus laevis GN=gapdh PE=2 SV=2 4 332 3.0E-166
sp|Q96UF2|G3P2_MUCCL Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Mucor circinelloides f. lusitanicus GN=GPD2 PE=3 SV=1 5 328 3.0E-166
sp|Q92243|G3P_LYOSH Glyceraldehyde-3-phosphate dehydrogenase OS=Lyophyllum shimeji GN=GPD PE=3 SV=1 4 336 4.0E-166
sp|O43026|G3P2_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpd3 PE=1 SV=1 1 335 4.0E-166
sp|P34921|G3PC_DIACA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1 1 334 5.0E-166
sp|O01360|G3P_ONCVO Glyceraldehyde-3-phosphate dehydrogenase OS=Onchocerca volvulus PE=2 SV=1 1 332 6.0E-166
sp|P56649|G3P_PANVR Glyceraldehyde-3-phosphate dehydrogenase OS=Panulirus versicolor PE=1 SV=1 5 336 8.0E-166
sp|Q94469|G3P_DICDI Glyceraldehyde-3-phosphate dehydrogenase OS=Dictyostelium discoideum GN=gpdA PE=1 SV=2 4 335 2.0E-165
sp|P34783|G3P_ATRNU Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1 1 334 8.0E-165
sp|P34922|G3PC_PEA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pisum sativum GN=GAPC1 PE=2 SV=1 2 333 9.0E-165
sp|Q09054|G3PC2_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Zea mays GN=GAPC2 PE=2 SV=1 1 334 1.0E-164
sp|A2YQT7|G3PC_ORYSI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Oryza sativa subsp. indica GN=GAPC PE=2 SV=1 1 334 2.0E-164
sp|Q0J8A4|G3PC1_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC1 PE=1 SV=1 1 334 2.0E-164
sp|P32810|G3P3_CAEBR Glyceraldehyde-3-phosphate dehydrogenase 3.1 OS=Caenorhabditis briggsae GN=gpd-3.1 PE=3 SV=1 1 332 3.0E-164
sp|Q92263|G3P_PICPA Glyceraldehyde-3-phosphate dehydrogenase OS=Komagataella pastoris GN=GPD PE=3 SV=1 4 333 3.0E-164
sp|Q43247|G3PC3_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Zea mays GN=GAPC3 PE=2 SV=1 1 334 4.0E-164
sp|P07487|G3P2_DROME Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila melanogaster GN=Gapdh2 PE=1 SV=2 5 335 4.0E-164
sp|P0A1P0|G3P_SALTY Glyceraldehyde-3-phosphate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gapA PE=3 SV=2 4 333 5.0E-164
sp|P0A1P1|G3P_SALTI Glyceraldehyde-3-phosphate dehydrogenase OS=Salmonella typhi GN=gapA PE=3 SV=2 4 333 5.0E-164
sp|P17330|G3P3_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Caenorhabditis elegans GN=gpd-3 PE=3 SV=1 1 332 5.0E-164
sp|P00357|G3P_HOMAM Glyceraldehyde-3-phosphate dehydrogenase OS=Homarus americanus PE=1 SV=2 5 336 5.0E-164
sp|P34923|G3PC_PHYPA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Physcomitrella patens subsp. patens GN=GAPC PE=2 SV=1 2 333 5.0E-164
sp|P07486|G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster GN=Gapdh1 PE=2 SV=2 5 335 7.0E-164
sp|P17329|G3P2_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans GN=gpd-2 PE=3 SV=2 6 332 8.0E-164
sp|P04970|G3P1_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Caenorhabditis elegans GN=gpd-1 PE=3 SV=1 1 332 8.0E-164
sp|P08735|G3PC1_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Zea mays GN=GAPC1 PE=2 SV=2 1 334 8.0E-164
sp|Q7FAH2|G3PC2_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC2 PE=1 SV=1 1 334 9.0E-164
sp|P80534|G3P_JACOR Glyceraldehyde-3-phosphate dehydrogenase, muscle OS=Jaculus orientalis PE=1 SV=2 4 335 1.0E-163
sp|Q42671|G3PC_CRAPL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1 1 332 1.0E-163
sp|P17331|G3P4_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 4 OS=Caenorhabditis elegans GN=gpd-4 PE=3 SV=1 1 332 2.0E-163
sp|I2BA89|G3P_SHIBC Glyceraldehyde-3-phosphate dehydrogenase OS=Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74) GN=gapA PE=3 SV=1 4 333 4.0E-163
sp|P0A9B5|G3P_SHIFL Glyceraldehyde-3-phosphate dehydrogenase OS=Shigella flexneri GN=gapA PE=3 SV=2 4 333 6.0E-163
sp|P0A9B3|G3P_ECOL6 Glyceraldehyde-3-phosphate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gapA PE=3 SV=2 4 333 6.0E-163
sp|P0A9B2|G3P1_ECOLI Glyceraldehyde-3-phosphate dehydrogenase A OS=Escherichia coli (strain K12) GN=gapA PE=1 SV=2 4 333 6.0E-163
sp|P0A9B4|G3P1_ECO57 Glyceraldehyde-3-phosphate dehydrogenase A OS=Escherichia coli O157:H7 GN=gapA PE=3 SV=2 4 333 6.0E-163
sp|Q28554|G3P_SHEEP Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Ovis aries GN=GAPDH PE=2 SV=4 14 335 9.0E-163
sp|B7LQ20|G3P_ESCF3 Glyceraldehyde-3-phosphate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gapA PE=3 SV=1 4 333 1.0E-162
sp|P25858|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic OS=Arabidopsis thaliana GN=GAPC1 PE=1 SV=2 4 333 1.0E-162
sp|O44104|G3P2_DROPS Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila pseudoobscura pseudoobscura GN=Gapdh2 PE=2 SV=2 5 335 1.0E-162
sp|P32809|G3P2_CAEBR Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caenorhabditis briggsae GN=gpd-2 PE=3 SV=1 1 332 2.0E-162
sp|P04796|G3PC_SINAL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2 4 333 3.0E-162
sp|P26520|G3PC_PETHY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1 1 335 3.0E-162
sp|Q6K5G8|G3PC3_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC3 PE=2 SV=1 1 335 4.0E-162
sp|Q9UVC0|G3P_WICCF Glyceraldehyde-3-phosphate dehydrogenase OS=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) GN=GPD PE=3 SV=2 4 332 6.0E-162
sp|Q9C136|G3P1_MUCCL Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Mucor circinelloides f. lusitanicus GN=GPD1 PE=2 SV=1 4 335 9.0E-162
sp|Q9FX54|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic OS=Arabidopsis thaliana GN=GAPC2 PE=1 SV=1 4 333 1.0E-161
sp|P34924|G3PC_PINSY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pinus sylvestris GN=GAPC PE=2 SV=1 4 334 1.0E-161
sp|P26517|G3PC1_HORVU Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Hordeum vulgare GN=GAPC PE=2 SV=1 1 334 2.0E-161
sp|Q64467|G3PT_MOUSE Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Mus musculus GN=Gapdhs PE=1 SV=1 4 331 2.0E-161
sp|Q96UF1|G3P3_MUCCL Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Mucor circinelloides f. lusitanicus GN=GPD3 PE=3 SV=1 1 335 3.0E-161
sp|Q5MJ86|G3P2_DANRE Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Danio rerio GN=gapdh-2 PE=2 SV=1 1 331 4.0E-161
sp|Q01982|G3P_PHACH Glyceraldehyde-3-phosphate dehydrogenase OS=Phanerochaete chrysosporium GN=GPD PE=3 SV=1 3 335 4.0E-161
sp|P26518|G3PC_MAGLI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1 4 332 4.0E-161
sp|Q39769|G3PC_GINBI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1 4 334 7.0E-161
sp|P17878|G3PC_MESCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Mesembryanthemum crystallinum GN=GAPC PE=2 SV=1 1 334 1.0E-160
sp|P54270|G3PC_GRAGA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Gracilaria gracilis GN=GAPC PE=3 SV=1 5 333 2.0E-160
sp|P26521|G3PC_RANAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1 4 334 2.0E-160
sp|Q01597|G3P_DROHY Glyceraldehyde-3-phosphate dehydrogenase OS=Drosophila hydei GN=Gapdh1 PE=3 SV=1 5 335 3.0E-160
sp|P10097|G3PC_TRYBB Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Trypanosoma brucei brucei PE=1 SV=3 4 333 6.0E-160
sp|Q757I2|G3P_ASHGO Glyceraldehyde-3-phosphate dehydrogenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPD PE=3 SV=2 4 332 7.0E-160
sp|P00359|G3P3_YEAST Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDH3 PE=1 SV=3 4 333 1.0E-159
sp|P17819|G3P1_KLULA Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAP1 PE=1 SV=1 4 332 2.0E-159
sp|Q41595|G3PC_TAXBA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Taxus baccata PE=2 SV=1 4 334 3.0E-159
sp|O59841|G3P_OGAPD Glyceraldehyde-3-phosphate dehydrogenase OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=GPD PE=3 SV=2 6 336 5.0E-159
sp|Q9ESV6|G3PT_RAT Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Rattus norvegicus GN=Gapdhs PE=1 SV=1 4 331 5.0E-159
sp|Q6CX23|G3P2_KLULA Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAP2 PE=3 SV=1 4 333 6.0E-159
sp|P26519|G3PC_PETCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petroselinum crispum GN=GAPC PE=2 SV=1 4 332 3.0E-158
sp|P32638|G3P_SCHCO Glyceraldehyde-3-phosphate dehydrogenase OS=Schizophyllum commune GN=GPD PE=3 SV=1 4 335 3.0E-158
sp|P00360|G3P1_YEAST Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDH1 PE=1 SV=3 4 333 3.0E-158
sp|P51640|G3P_MESAU Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Mesocricetus auratus GN=GAPDH PE=2 SV=1 13 324 1.0E-157
sp|Q27652|G3P_ECHMU Glyceraldehyde-3-phosphate dehydrogenase OS=Echinococcus multilocularis PE=2 SV=1 1 335 4.0E-157
sp|P00358|G3P2_YEAST Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDH2 PE=1 SV=3 4 333 8.0E-157
sp|O14556|G3PT_HUMAN Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Homo sapiens GN=GAPDHS PE=1 SV=2 4 335 9.0E-157
sp|P09094|G3PC_TOBAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1 12 332 1.0E-156
sp|P08439|G3P_ZYGRO Glyceraldehyde-3-phosphate dehydrogenase OS=Zygosaccharomyces rouxii PE=3 SV=1 4 334 2.0E-156
sp|Q6FSM4|G3P2_CANGA Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPD2 PE=3 SV=1 4 333 3.0E-156
sp|P26988|G3P_PHYIN Glyceraldehyde-3-phosphate dehydrogenase OS=Phytophthora infestans GN=GPDA PE=3 SV=1 4 335 9.0E-156
sp|P84998|G3P1_KLUMA Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluyveromyces marxianus GN=GAP1 PE=1 SV=1 4 332 9.0E-156
sp|Q01077|G3P2_KLUMA Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Kluyveromyces marxianus GN=GAP2 PE=3 SV=2 4 333 2.0E-155
sp|Q6FPW3|G3P1_CANGA Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPD1 PE=3 SV=1 4 333 3.0E-155
sp|P84999|G3P3_KLUMA Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Kluyveromyces marxianus GN=GAP3 PE=1 SV=1 4 333 5.0E-155
sp|P34920|G3PC_CHOCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Chondrus crispus GN=GAPC PE=2 SV=1 1 333 8.0E-155
sp|O42259|G3P_ONCMY Glyceraldehyde-3-phosphate dehydrogenase OS=Oncorhynchus mykiss GN=gapdh PE=2 SV=1 1 331 2.0E-154
sp|Q9UW96|G3P_PLESA Glyceraldehyde-3-phosphate dehydrogenase OS=Pleurotus sajor-caju GN=GPD PE=2 SV=1 4 338 2.0E-152
sp|O16027|G3P1_GLORO Glyceraldehyde-3-phosphate dehydrogenase 1 (Fragment) OS=Globodera rostochiensis GN=GPD-1 PE=2 SV=1 1 318 8.0E-152
sp|P44304|G3P_HAEIN Glyceraldehyde-3-phosphate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gapA PE=3 SV=1 4 331 8.0E-151
sp|Q4R3T1|G3PT_MACFA Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Macaca fascicularis GN=GAPDHS PE=2 SV=1 4 335 1.0E-150
sp|P49644|G3PC_CHLRE Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Chlamydomonas reinhardtii GN=GAPC PE=3 SV=1 4 338 1.0E-150
sp|Q01558|G3PC_LEIME Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Leishmania mexicana GN=GAPC PE=3 SV=3 4 330 3.0E-150
sp|Q07234|G3P_BUCAP Glyceraldehyde-3-phosphate dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gapA PE=3 SV=2 4 332 2.0E-149
sp|Q8VXQ8|G3PC_SCEVA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Scenedesmus vacuolatus GN=GapC PE=2 SV=1 9 319 3.0E-149
sp|O44105|G3P2_DROSU Glyceraldehyde-3-phosphate dehydrogenase 2 (Fragment) OS=Drosophila subobscura GN=Gapdh2 PE=2 SV=1 13 317 2.0E-148
sp|P52694|G3P_RALSO Glyceraldehyde-3-phosphate dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=gapA PE=3 SV=2 4 333 4.0E-148
sp|Q2KJE5|G3PT_BOVIN Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Bos taurus GN=GAPDHS PE=2 SV=1 6 335 2.0E-147
sp|Q59199|G3P_BACFR Glyceraldehyde-3-phosphate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=gap PE=3 SV=2 4 332 5.0E-146
sp|P24164|G3P_KLEPN Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Klebsiella pneumoniae GN=gap PE=3 SV=2 8 311 2.0E-145
sp|P08477|G3PC2_HORVU Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic (Fragment) OS=Hordeum vulgare GN=GAPC PE=2 SV=1 33 334 3.0E-144
sp|P57384|G3P_BUCAI Glyceraldehyde-3-phosphate dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gapA PE=3 SV=1 4 333 1.0E-143
sp|P55070|G3P_LACDT Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Lactarius deterrimus GN=GPD PE=3 SV=1 26 312 1.0E-142
sp|Q89AK1|G3P_BUCBP Glyceraldehyde-3-phosphate dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gapA PE=3 SV=1 4 332 8.0E-142
sp|P32635|G3P1_AGABI Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Agaricus bisporus GN=gpd1 PE=3 SV=1 4 335 1.0E-141
sp|P80506|G3P1_NOSS1 Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gap1 PE=1 SV=3 1 335 2.0E-140
sp|P34916|G3P1_ANAVT Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gap1 PE=3 SV=4 1 335 2.0E-140
sp|P24748|G3P_CITFR Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Citrobacter freundii GN=gap PE=3 SV=1 17 311 6.0E-139
sp|P24751|G3P_ESCVU Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Escherichia vulneris GN=gap PE=3 SV=1 17 311 1.0E-138
sp|P0DJO7|G3P_SHIBL Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Shimwellia blattae GN=gap PE=3 SV=1 17 311 7.0E-138
sp|P0C8Z1|G3P_ESCFE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Escherichia fergusonii GN=gapA PE=3 SV=1 17 311 2.0E-137
sp|P24750|G3P_ESCHE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Escherichia hermannii GN=gap PE=3 SV=1 17 311 5.0E-137
sp|P24163|G3P_ENTAE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Enterobacter aerogenes GN=gap PE=3 SV=1 17 311 8.0E-137
sp|P49433|G3P1_SYNY3 Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gap1 PE=3 SV=1 4 335 1.0E-136
sp|P24166|G3P_SERMA Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Serratia marcescens GN=gap PE=3 SV=1 17 311 7.0E-136
sp|P55071|G3P_AMAMU Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Amanita muscaria GN=GPD PE=3 SV=1 27 312 4.0E-134
sp|Q9Z7T0|G3P_CHLPN Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia pneumoniae GN=gap PE=3 SV=1 4 333 3.0E-133
sp|P24753|G3P_SEROD Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Serratia odorifera GN=gap PE=3 SV=1 17 311 3.0E-133
sp|Q9N655|G3P_MASBA Glyceraldehyde-3-phosphate dehydrogenase OS=Mastigamoeba balamuthi GN=GAPD PE=2 SV=1 5 326 3.0E-132
sp|P53429|G3P1_GIAIN Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Giardia intestinalis GN=GAP1 PE=3 SV=1 3 331 5.0E-132
sp|O09452|G3PA_GUITH Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Guillardia theta GN=GAPC1 PE=2 SV=1 1 336 8.0E-131
sp|Q00301|G3P_BOLED Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Boletus edulis GN=GPD PE=3 SV=1 23 312 1.0E-130
sp|B0B879|G3P_CHLT2 Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gap PE=3 SV=1 4 333 1.0E-130
sp|Q9PJN6|G3P_CHLMU Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gap PE=3 SV=1 4 331 2.0E-129
sp|P0CE13|G3P_CHLTR Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gap PE=3 SV=1 4 333 2.0E-129
sp|P00362|G3P_GEOSE Glyceraldehyde-3-phosphate dehydrogenase OS=Geobacillus stearothermophilus GN=gap PE=1 SV=5 4 332 3.0E-127
sp|O57672|G3P_MELGA Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Meleagris gallopavo GN=GAPDH PE=2 SV=1 92 325 2.0E-126
sp|P09124|G3P1_BACSU Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus subtilis (strain 168) GN=gapA PE=1 SV=2 4 333 1.0E-123
sp|P23722|G3P_BACMD Glyceraldehyde-3-phosphate dehydrogenase OS=Bacillus megaterium (strain DSM 319) GN=gap PE=3 SV=3 4 332 6.0E-121
sp|Q4MQ58|G3P1_BACCE Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus cereus GN=gap1 PE=1 SV=3 5 331 1.0E-120
sp|P22512|G3PG_TRYBB Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Trypanosoma brucei brucei PE=1 SV=3 4 335 2.0E-119
sp|Q27890|G3PG_LEIME Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Leishmania mexicana GN=GAPG PE=1 SV=3 1 336 1.0E-118
sp|P22513|G3PG_TRYCR Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Trypanosoma cruzi PE=1 SV=1 3 335 2.0E-118
sp|O96423|G3PG_CRIFA Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Crithidia fasciculata GN=GAPDG PE=3 SV=3 1 335 2.0E-118
sp|P17721|G3P_THEMA Glyceraldehyde-3-phosphate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gap PE=1 SV=2 5 333 9.0E-109
sp|A0QWW2|G3P_MYCS2 Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gapA PE=1 SV=1 4 334 6.0E-108
sp|Q829W3|G3P2_STRAW Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gap2 PE=1 SV=1 4 331 6.0E-107
sp|P15115|G3P_BACCO Glyceraldehyde-3-phosphate dehydrogenase OS=Bacillus coagulans GN=gap PE=1 SV=2 3 331 7.0E-107
sp|O34425|G3P2_BACSU Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=gapB PE=1 SV=1 4 332 1.0E-106
sp|O83816|G3P_TREPA Glyceraldehyde-3-phosphate dehydrogenase OS=Treponema pallidum (strain Nichols) GN=gap PE=3 SV=1 4 333 2.0E-106
sp|P94915|G3P_MYCAV Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium avium GN=gapA PE=3 SV=3 4 334 5.0E-106
sp|P58554|G3P2_NOSS1 Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gap2 PE=1 SV=1 4 333 5.0E-106
sp|P34917|G3P2_ANAVT Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gap2 PE=3 SV=2 4 333 6.0E-106
sp|P9WN83|G3P_MYCTU Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gap PE=1 SV=1 4 334 7.0E-106
sp|P9WN82|G3P_MYCTO Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gap PE=3 SV=1 4 334 7.0E-106
sp|P64179|G3P_MYCBO Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gap PE=3 SV=1 4 334 7.0E-106
sp|Q9Z518|G3P_STRCO Glyceraldehyde-3-phosphate dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gap PE=3 SV=1 4 327 2.0E-105
sp|P46795|G3P_BORBU Glyceraldehyde-3-phosphate dehydrogenase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gap PE=1 SV=3 4 333 4.0E-105
sp|P46713|G3P_MYCLE Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=gapA PE=3 SV=1 4 334 4.0E-104
sp|O67161|G3P_AQUAE Glyceraldehyde-3-phosphate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=gap PE=1 SV=1 4 333 9.0E-104
sp|P75358|G3P_MYCPN Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gapA PE=3 SV=1 4 333 1.0E-101
sp|E3VWI2|G3P2_STRAE Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Streptomyces arenae GN=gap2 PE=1 SV=1 4 334 1.0E-100
sp|P00361|G3P_THEAQ Glyceraldehyde-3-phosphate dehydrogenase OS=Thermus aquaticus GN=gap PE=1 SV=2 4 333 3.0E-100
sp|P50321|G3PC_CUPNH Glyceraldehyde-3-phosphate dehydrogenase, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbGC PE=3 SV=1 4 330 7.0E-100
sp|P58072|G3P2_ECO57 Glyceraldehyde-3-phosphate dehydrogenase C OS=Escherichia coli O157:H7 GN=gapC PE=3 SV=1 5 333 8.0E-100
sp|P50322|G3PP_CUPNH Glyceraldehyde-3-phosphate dehydrogenase, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbGP PE=3 SV=1 4 330 1.0E-99
sp|P0A038|G3P_STAAU Glyceraldehyde-3-phosphate dehydrogenase OS=Staphylococcus aureus GN=gapA PE=3 SV=1 4 333 2.0E-99
sp|P0A037|G3P1_STAAW Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain MW2) GN=gapA1 PE=3 SV=1 4 333 2.0E-99
sp|Q6GB58|G3P1_STAAS Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain MSSA476) GN=gapA1 PE=3 SV=1 4 333 2.0E-99
sp|Q6GIL8|G3P1_STAAR Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain MRSA252) GN=gapA1 PE=1 SV=1 4 333 2.0E-99
sp|P99136|G3P1_STAAN Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain N315) GN=gapA1 PE=1 SV=1 4 333 2.0E-99
sp|P0A036|G3P1_STAAM Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gapA1 PE=3 SV=1 4 333 2.0E-99
sp|Q5HHP5|G3P1_STAAC Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain COL) GN=gapA1 PE=3 SV=1 4 333 2.0E-99
sp|P54226|G3P1_STRAE Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Streptomyces arenae GN=gap1 PE=1 SV=1 4 334 4.0E-99
sp|Q59309|G3P_CLOPA Glyceraldehyde-3-phosphate dehydrogenase OS=Clostridium pasteurianum GN=gap PE=1 SV=1 5 333 6.0E-99
sp|Q82IZ2|G3P1_STRAW Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gap1 PE=1 SV=1 4 334 7.0E-99
sp|P33898|G3P2_ECOLI Putative glyceraldehyde-3-phosphate dehydrogenase C OS=Escherichia coli (strain K12) GN=gapC PE=5 SV=2 5 333 1.0E-98
sp|P47543|G3P_MYCGE Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gapA PE=3 SV=1 4 333 3.0E-98
sp|Q59800|G3P_STRAU Glyceraldehyde-3-phosphate dehydrogenase OS=Streptomyces aureofaciens GN=gap PE=3 SV=1 5 332 4.0E-98
sp|P25857|G3PB_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2 1 331 3.0E-97
sp|P64181|G3P2_STAAW Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain MW2) GN=gapA2 PE=3 SV=1 6 331 4.0E-97
sp|Q6G8N9|G3P2_STAAS Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain MSSA476) GN=gapA2 PE=3 SV=1 6 331 4.0E-97
sp|P99067|G3P2_STAAN Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain N315) GN=gapA2 PE=1 SV=1 6 331 4.0E-97
sp|P64180|G3P2_STAAM Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gapA2 PE=3 SV=1 6 331 4.0E-97
sp|Q5HF86|G3P2_STAAC Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain COL) GN=gapA2 PE=3 SV=1 6 331 4.0E-97
sp|Q6GG19|G3P2_STAAR Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain MRSA252) GN=gapA2 PE=3 SV=1 6 331 5.0E-97
sp|P09316|G3P_ZYMMO Glyceraldehyde-3-phosphate dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gap PE=3 SV=1 4 334 3.0E-96
sp|Q8CPY5|G3P1_STAES Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gapA1 PE=3 SV=1 4 333 3.0E-96
sp|Q5HQV4|G3P1_STAEQ Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gapA1 PE=3 SV=1 4 333 3.0E-96
sp|Q8CNY0|G3P2_STAES Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gapA2 PE=3 SV=1 6 333 6.0E-96
sp|O52631|G3P_CLOAB Glyceraldehyde-3-phosphate dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gap PE=1 SV=1 5 333 7.0E-96
sp|Q5HNL7|G3P2_STAEQ Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gapA2 PE=3 SV=1 6 333 1.0E-95
sp|P80505|G3P2_SYNY3 Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gap2 PE=1 SV=3 5 333 8.0E-95
sp|P12860|G3PB_SPIOL Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1 1 332 9.0E-95
sp|P34919|G3PA_CHOCR Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Chondrus crispus GN=GAPA PE=2 SV=1 4 333 2.0E-94
sp|P29272|G3P_RHOSH Glyceraldehyde-3-phosphate dehydrogenase OS=Rhodobacter sphaeroides GN=gapB PE=3 SV=1 4 326 2.0E-94
sp|Q01651|G3P_CORGL Glyceraldehyde-3-phosphate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gap PE=3 SV=2 4 332 2.0E-93
sp|P0DB19|G3P_STRPQ Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gap PE=3 SV=1 4 333 2.0E-92
sp|P0DB18|G3P_STRP3 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gap PE=3 SV=1 4 333 2.0E-92
sp|P30724|G3PA_GRAGA Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Gracilaria gracilis GN=GAPA PE=2 SV=1 4 327 3.0E-92
sp|P0C0G6|G3P_STRPY Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes GN=gap PE=1 SV=2 4 333 7.0E-92
sp|P68777|G3P_STRP8 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gap PE=3 SV=2 4 333 9.0E-92
sp|Q5XDW3|G3P_STRP6 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gap PE=1 SV=3 4 333 9.0E-92
sp|P0C0G7|G3P_STRP1 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=gap PE=3 SV=2 4 333 9.0E-92
sp|P19866|G3PA_SPIOL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2 2 327 1.0E-90
sp|P27726|G3P_PSEAE Glyceraldehyde-3-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gap PE=3 SV=3 4 326 6.0E-90
sp|O32755|G3P_LACDE Glyceraldehyde-3-phosphate dehydrogenase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=gap PE=3 SV=1 4 332 8.0E-90
sp|P12859|G3PB_PEA Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2 1 331 8.0E-90
sp|Q48335|G3P_HALVA Glyceraldehyde-3-phosphate dehydrogenase OS=Haloarcula vallismortis GN=gap PE=3 SV=1 3 333 4.0E-89
sp|P12858|G3PA_PEA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2 4 327 1.0E-88
sp|P09044|G3PB_TOBAC Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1 1 331 3.0E-88
sp|P51009|G3P_XANFL Glyceraldehyde-3-phosphate dehydrogenase OS=Xanthobacter flavus GN=gap PE=3 SV=1 4 333 4.0E-88
sp|Q9LPW0|G3PA2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic OS=Arabidopsis thaliana GN=GAPA2 PE=2 SV=1 2 327 1.0E-87
sp|P52987|G3P_LACLA Glyceraldehyde-3-phosphate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gap PE=3 SV=2 4 333 2.0E-87
sp|Q59906|G3P_STREQ Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus dysgalactiae subsp. equisimilis GN=gap PE=1 SV=2 4 333 1.0E-86
sp|P50362|G3PA_CHLRE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1 4 333 4.0E-86
sp|P25856|G3PA1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic OS=Arabidopsis thaliana GN=GAPA1 PE=1 SV=3 2 327 9.0E-86
sp|P09315|G3PA_MAIZE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1 2 327 1.0E-85
sp|P58559|G3P3_NOSS1 Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gap3 PE=2 SV=1 4 332 1.0E-83
sp|P34918|G3P3_ANAVT Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gap3 PE=1 SV=2 4 332 1.0E-82
sp|A0KGD2|E4PD_AERHH D-erythrose-4-phosphate dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=epd PE=3 SV=1 4 326 8.0E-81
sp|Q8VXQ9|G3PA_SCEVA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Scenedesmus vacuolatus GN=GapA PE=2 SV=1 9 319 5.0E-80
sp|A4SRF2|E4PD_AERS4 D-erythrose-4-phosphate dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=epd PE=3 SV=1 4 326 8.0E-80
sp|P09043|G3PA_TOBAC Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1 2 327 7.0E-79
sp|A0L0K7|E4PD_SHESA D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=epd PE=3 SV=1 4 332 3.0E-78
sp|Q8EIB2|E4PD_SHEON D-erythrose-4-phosphate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=epd PE=3 SV=1 4 332 5.0E-78
sp|Q0HRM3|E4PD_SHESR D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-7) GN=epd PE=3 SV=1 4 332 5.0E-78
sp|Q3ILL8|E4PD_PSEHT D-erythrose-4-phosphate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=epd PE=3 SV=1 4 326 6.0E-78
sp|A8H0M9|E4PD_SHEPA D-erythrose-4-phosphate dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=epd PE=3 SV=1 4 326 1.0E-77
sp|Q7N7Z6|E4PD_PHOLL D-erythrose-4-phosphate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=epd PE=3 SV=1 4 326 1.0E-77
sp|Q0HM63|E4PD_SHESM D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-4) GN=epd PE=3 SV=1 4 332 1.0E-77
sp|B8CU41|E4PD_SHEPW D-erythrose-4-phosphate dehydrogenase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=epd PE=3 SV=1 4 326 2.0E-77
sp|Q5QVL6|E4PD_IDILO D-erythrose-4-phosphate dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=epd PE=3 SV=1 3 326 3.0E-77
sp|Q087Q7|E4PD_SHEFN D-erythrose-4-phosphate dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=epd PE=3 SV=1 4 326 5.0E-77
sp|B0TUC0|E4PD_SHEHH D-erythrose-4-phosphate dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=epd PE=3 SV=1 4 326 7.0E-77
sp|B4RWC5|E4PD_ALTMD D-erythrose-4-phosphate dehydrogenase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=epd PE=3 SV=1 4 326 2.0E-76
sp|A3QAX7|E4PD_SHELP D-erythrose-4-phosphate dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=epd PE=3 SV=1 4 326 2.0E-76
sp|P46796|G3P_BORHE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Borrelia hermsii GN=gap PE=3 SV=1 37 290 5.0E-76
sp|A1RN69|E4PD_SHESW D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=epd PE=3 SV=1 4 332 7.0E-76
sp|A9N3Q6|E4PD_SALPB D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=epd PE=3 SV=1 4 326 9.0E-76
sp|Q15QK3|E4PD_PSEA6 D-erythrose-4-phosphate dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=epd PE=3 SV=1 4 328 1.0E-75
sp|A4Y3R9|E4PD_SHEPC D-erythrose-4-phosphate dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=epd PE=3 SV=1 4 332 2.0E-75
sp|B5RE31|E4PD_SALG2 D-erythrose-4-phosphate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=epd PE=3 SV=1 4 326 2.0E-75
sp|B8E5U5|E4PD_SHEB2 D-erythrose-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS223) GN=epd PE=3 SV=1 4 332 2.0E-75
sp|B4TV39|E4PD_SALSV D-erythrose-4-phosphate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|Q7CPU5|E4PD_SALTY D-erythrose-4-phosphate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|Q8XGA4|E4PD_SALTI D-erythrose-4-phosphate dehydrogenase OS=Salmonella typhi GN=epd PE=3 SV=1 4 326 3.0E-75
sp|C0PY46|E4PD_SALPC D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|B4T5H2|E4PD_SALNS D-erythrose-4-phosphate dehydrogenase OS=Salmonella newport (strain SL254) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|B4THF4|E4PD_SALHS D-erythrose-4-phosphate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|Q57K44|E4PD_SALCH D-erythrose-4-phosphate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|B5F5J5|E4PD_SALA4 D-erythrose-4-phosphate dehydrogenase OS=Salmonella agona (strain SL483) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|B5QXJ7|E4PD_SALEP D-erythrose-4-phosphate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|B5FUI3|E4PD_SALDC D-erythrose-4-phosphate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=epd PE=3 SV=1 4 326 3.0E-75
sp|B5BFN5|E4PD_SALPK D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=epd PE=3 SV=1 4 335 5.0E-75
sp|Q5PJI5|E4PD_SALPA D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=epd PE=3 SV=1 4 335 5.0E-75
sp|A8APE1|E4PD_CITK8 D-erythrose-4-phosphate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=epd PE=3 SV=1 4 326 5.0E-75
sp|Q6LMN0|E4PD_PHOPR D-erythrose-4-phosphate dehydrogenase OS=Photobacterium profundum GN=epd PE=3 SV=2 4 338 8.0E-75
sp|B4EUH7|E4PD_PROMH D-erythrose-4-phosphate dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=epd PE=3 SV=1 4 334 8.0E-75
sp|Q9ZKT0|G3P_HELPJ Glyceraldehyde-3-phosphate dehydrogenase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gapA PE=3 SV=1 4 327 1.0E-74
sp|B7LPD5|E4PD_ESCF3 D-erythrose-4-phosphate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=epd PE=3 SV=1 4 326 1.0E-74
sp|Q12QA4|E4PD_SHEDO D-erythrose-4-phosphate dehydrogenase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=epd PE=3 SV=2 4 326 2.0E-74
sp|C6DFH8|E4PD_PECCP D-erythrose-4-phosphate dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|Q3YXU5|E4PD_SHISS D-erythrose-4-phosphate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|P0A9B9|E4PD_SHIFL D-erythrose-4-phosphate dehydrogenase OS=Shigella flexneri GN=epd PE=3 SV=2 4 326 3.0E-74
sp|Q0T0X3|E4PD_SHIF8 D-erythrose-4-phosphate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|Q31WI6|E4PD_SHIBS D-erythrose-4-phosphate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B2U0U3|E4PD_SHIB3 D-erythrose-4-phosphate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B1LDD2|E4PD_ECOSM D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B6I761|E4PD_ECOSE D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain SE11) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B7N7H3|E4PD_ECOLU D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|P0A9B6|E4PD_ECOLI D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain K12) GN=epd PE=1 SV=2 4 326 3.0E-74
sp|B1IT76|E4PD_ECOLC D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|P0A9B7|E4PD_ECOL6 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=epd PE=3 SV=2 4 326 3.0E-74
sp|Q0TDS9|E4PD_ECOL5 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|A8A467|E4PD_ECOHS D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B1XEL0|E4PD_ECODH D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|C5A0J7|E4PD_ECOBW D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B7LYU4|E4PD_ECO8A D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B5YQB9|E4PD_ECO5E D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|P0A9B8|E4PD_ECO57 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 GN=epd PE=3 SV=2 4 326 3.0E-74
sp|B7LFI3|E4PD_ECO55 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|A7ZR35|E4PD_ECO24 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|A9MRF0|E4PD_SALAR D-erythrose-4-phosphate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=epd PE=3 SV=1 4 326 4.0E-74
sp|Q1R7A6|E4PD_ECOUT D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=epd PE=3 SV=2 4 326 5.0E-74
sp|B7MZM0|E4PD_ECO81 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=epd PE=3 SV=1 4 326 5.0E-74
sp|B7UHW9|E4PD_ECO27 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=epd PE=3 SV=1 4 326 5.0E-74
sp|Q32BY7|E4PD_SHIDS D-erythrose-4-phosphate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=epd PE=3 SV=1 4 326 5.0E-74
sp|A7MJQ2|E4PD_CROS8 D-erythrose-4-phosphate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=epd PE=3 SV=1 4 326 5.0E-74
sp|B5XUB7|E4PD_KLEP3 D-erythrose-4-phosphate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=epd PE=3 SV=1 4 326 6.0E-74
sp|P55971|G3P_HELPY Glyceraldehyde-3-phosphate dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gapA PE=3 SV=1 4 327 1.0E-73
sp|A6TDT2|E4PD_KLEP7 D-erythrose-4-phosphate dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=epd PE=3 SV=1 4 326 2.0E-73
sp|A1S9A4|E4PD_SHEAM D-erythrose-4-phosphate dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=epd PE=3 SV=1 4 336 2.0E-73
sp|B7NHY6|E4PD_ECO7I D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=epd PE=3 SV=1 4 326 2.0E-73
sp|A1AFB1|E4PD_ECOK1 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=epd PE=3 SV=1 4 326 3.0E-73
sp|B7MMA9|E4PD_ECO45 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=epd PE=3 SV=1 4 326 3.0E-73
sp|A4WE72|E4PD_ENT38 D-erythrose-4-phosphate dehydrogenase OS=Enterobacter sp. (strain 638) GN=epd PE=3 SV=1 4 326 3.0E-73
sp|Q6D086|E4PD_PECAS D-erythrose-4-phosphate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=epd PE=3 SV=1 4 326 8.0E-72
sp|Q7MHL0|E4PD_VIBVY D-erythrose-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=epd PE=3 SV=1 4 326 1.0E-70
sp|Q8DCA1|E4PD_VIBVU D-erythrose-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=epd PE=3 SV=1 4 326 1.0E-70
sp|A7MTQ2|E4PD_VIBCB D-erythrose-4-phosphate dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=epd PE=3 SV=1 4 326 1.0E-70
sp|Q87LL0|E4PD_VIBPA D-erythrose-4-phosphate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=epd PE=3 SV=1 4 326 1.0E-70
sp|B5F9T4|E4PD_VIBFM D-erythrose-4-phosphate dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=epd PE=3 SV=1 4 326 3.0E-70
sp|B6EMW1|E4PD_ALISL D-erythrose-4-phosphate dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=epd PE=3 SV=1 4 326 5.0E-70
sp|A1JPR1|E4PD_YERE8 D-erythrose-4-phosphate dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=epd PE=3 SV=1 4 334 8.0E-70
sp|P0C6C2|E4PD_VIBCH D-erythrose-4-phosphate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=epd PE=3 SV=1 4 326 2.0E-69
sp|A5F9G1|E4PD_VIBC3 D-erythrose-4-phosphate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=epd PE=1 SV=2 4 326 2.0E-69
sp|Q5E7R0|E4PD_VIBF1 D-erythrose-4-phosphate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=epd PE=3 SV=1 4 326 4.0E-69
sp|Q666Q0|E4PD_YERPS D-erythrose-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=epd PE=3 SV=1 4 334 1.0E-68
sp|Q1CEY2|E4PD_YERPN D-erythrose-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=epd PE=3 SV=1 4 334 1.0E-68
sp|Q7CGS4|E4PD_YERPE D-erythrose-4-phosphate dehydrogenase OS=Yersinia pestis GN=epd PE=3 SV=1 4 334 1.0E-68
sp|Q1CB62|E4PD_YERPA D-erythrose-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=epd PE=3 SV=1 4 334 1.0E-68
sp|A1SVN9|E4PD_PSYIN D-erythrose-4-phosphate dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=epd PE=3 SV=1 4 332 5.0E-68
sp|C4L9J3|E4PD_TOLAT D-erythrose-4-phosphate dehydrogenase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=epd PE=3 SV=1 4 333 7.0E-68
sp|C5BAU7|E4PD_EDWI9 D-erythrose-4-phosphate dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=epd PE=3 SV=1 4 333 5.0E-67
sp|B2VF24|E4PD_ERWT9 D-erythrose-4-phosphate dehydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=epd PE=3 SV=1 4 326 6.0E-67
sp|Q47XD5|E4PD_COLP3 D-erythrose-4-phosphate dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=epd PE=3 SV=1 4 326 1.0E-64
sp|P09672|G3PA_SINAL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Sinapis alba GN=GAPA PE=2 SV=1 108 327 3.0E-58
sp|P70685|G3P_CAVPO Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Cavia porcellus GN=GAPDH PE=2 SV=2 169 290 4.0E-58
sp|Q02PG5|GAP2_PSEAB Glyceraldehyde-3-phosphate dehydrogenase-like protein OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gap2 PE=1 SV=1 10 332 4.0E-46
sp|P86211|G3PT_MESAU Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (Fragments) OS=Mesocricetus auratus GN=GAPDHS PE=1 SV=1 4 55 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1349
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4828 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3294
Ophiocordyceps camponoti-floridani Ophcf2|06693
Ophiocordyceps camponoti-rufipedis Ophun1|6317
Ophiocordyceps kimflemingae Ophio5|4177
Ophiocordyceps subramaniannii Hirsu2|10752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4828
MAPIKVGINGFGRIGRIVFRNAVEHPEIEIVAVNDPFIDPKYAEYMLKYDSTHGRFKPQVAVNGNDLSIDGKKVK
FYTERDPAAIPWKETGAQYIVESTGVFTTTDKAKAHLTGGAKKVIISAPSADAPMYVMGVNEKTYDGKADVISNA
SCTTNCLAPLAKVIHDNFGIVEGLMTTIHSYTATQKTVDGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPDLN
GKLTGMSMRVPTANVSVVDLTVRLEKSATYDQIKEVVKKSAAGPLKGILDYTEDEVVSSDMNGNTASSIFDAKAG
ISLNPNFVKLVSWYDNEWGYSRRVLDLLAHIAKTDAGK*
Coding >OphauG2|4828
ATGGCTCCCATCAAGGTTGGCATCAACGGCTTTGGCCGCATCGGTCGTATTGTCTTCCGCAACGCCGTTGAGCAT
CCTGAGATTGAGATTGTTGCCGTCAACGATCCCTTCATCGACCCCAAGTATGCTGAGTACATGCTCAAATATGAC
TCAACGCACGGCCGGTTCAAACCTCAAGTTGCCGTCAATGGCAACGACCTGTCCATCGATGGCAAGAAGGTCAAG
TTCTACACGGAACGCGACCCCGCTGCCATTCCCTGGAAGGAGACGGGAGCCCAGTACATTGTCGAGTCAACTGGT
GTCTTCACCACCACGGACAAGGCCAAGGCTCACTTGACTGGTGGTGCCAAAAAGGTCATCATCTCGGCTCCCTCG
GCCGATGCTCCCATGTACGTCATGGGTGTTAATGAGAAGACGTACGACGGCAAGGCCGATGTCATCTCCAACGCC
TCATGCACCACCAACTGCCTCGCCCCGCTCGCAAAGGTCATCCACGACAACTTTGGCATCGTCGAGGGTCTCATG
ACCACTATCCACTCCTATACGGCCACGCAAAAGACGGTTGACGGCCCCTCAGCCAAGGACTGGCGCGGTGGTCGC
GGTGCCGCTCAGAACATTATTCCCAGCAGCACCGGTGCCGCCAAGGCTGTTGGCAAGGTGATTCCCGATCTCAAT
GGCAAGCTCACAGGCATGTCGATGCGTGTCCCCACGGCCAACGTATCCGTCGTCGACCTGACGGTTCGTCTCGAA
AAGAGTGCCACCTATGATCAGATCAAGGAGGTTGTCAAGAAGTCTGCTGCCGGTCCCCTCAAGGGCATCCTTGAC
TACACTGAAGATGAAGTCGTTTCGAGCGACATGAATGGCAACACTGCCTCATCCATTTTTGATGCCAAGGCCGGC
ATCTCTCTCAACCCCAACTTTGTCAAGCTCGTCAGCTGGTACGACAACGAATGGGGTTACTCGCGTCGTGTCCTT
GATCTCCTCGCCCACATTGCCAAGACTGATGCTGGTAAATAA
Transcript >OphauG2|4828
ATGGCTCCCATCAAGGTTGGCATCAACGGCTTTGGCCGCATCGGTCGTATTGTCTTCCGCAACGCCGTTGAGCAT
CCTGAGATTGAGATTGTTGCCGTCAACGATCCCTTCATCGACCCCAAGTATGCTGAGTACATGCTCAAATATGAC
TCAACGCACGGCCGGTTCAAACCTCAAGTTGCCGTCAATGGCAACGACCTGTCCATCGATGGCAAGAAGGTCAAG
TTCTACACGGAACGCGACCCCGCTGCCATTCCCTGGAAGGAGACGGGAGCCCAGTACATTGTCGAGTCAACTGGT
GTCTTCACCACCACGGACAAGGCCAAGGCTCACTTGACTGGTGGTGCCAAAAAGGTCATCATCTCGGCTCCCTCG
GCCGATGCTCCCATGTACGTCATGGGTGTTAATGAGAAGACGTACGACGGCAAGGCCGATGTCATCTCCAACGCC
TCATGCACCACCAACTGCCTCGCCCCGCTCGCAAAGGTCATCCACGACAACTTTGGCATCGTCGAGGGTCTCATG
ACCACTATCCACTCCTATACGGCCACGCAAAAGACGGTTGACGGCCCCTCAGCCAAGGACTGGCGCGGTGGTCGC
GGTGCCGCTCAGAACATTATTCCCAGCAGCACCGGTGCCGCCAAGGCTGTTGGCAAGGTGATTCCCGATCTCAAT
GGCAAGCTCACAGGCATGTCGATGCGTGTCCCCACGGCCAACGTATCCGTCGTCGACCTGACGGTTCGTCTCGAA
AAGAGTGCCACCTATGATCAGATCAAGGAGGTTGTCAAGAAGTCTGCTGCCGGTCCCCTCAAGGGCATCCTTGAC
TACACTGAAGATGAAGTCGTTTCGAGCGACATGAATGGCAACACTGCCTCATCCATTTTTGATGCCAAGGCCGGC
ATCTCTCTCAACCCCAACTTTGTCAAGCTCGTCAGCTGGTACGACAACGAATGGGGTTACTCGCGTCGTGTCCTT
GATCTCCTCGCCCACATTGCCAAGACTGATGCTGGTAAATAA
Gene >OphauG2|4828
ATGGCTCCCATCAAGGTTGGCATCAACGGCTTTGGCCGCATCGGTCGTATTGTCTTCCGCAACGCCGTTGAGCAT
CCTGAGATTGAGATTGTTGCCGTCAACGATCCCTTCATCGACCCCAAGTATGCTGTAAGTTACATCTTTACCCCG
CCATCCGCAACCATGCAATTTTCTCGTCTTGCCCCTCCTTGCTTCTATGAAGCCCAGAGAGGCCATTCCCCGCTT
CCTCACTTGCCAATCCTTTTCTCGTCAATCTTTTCATCTCGTTGTATCCTCTTTATCCCTTGTCTCGACCCGATA
AACGTCTGCTTACGCTTGTCTCCCAATTTATAGGAGTACATGCTCAAATATGACTCAACGCACGGCCGGTTCAAA
CCTCAAGTTGCCGTCAATGGCAACGACCTGTCCATCGATGGCAAGAAGGTCAAGTTCTACACGGAACGCGACCCC
GCTGCCATTCCCTGGAAGGAGACGGGAGCCCAGTACATTGTCGAGTCAACTGGTGTCTTCACCACCACGGACAAG
GCCAAGGCTCACTTGACTGGTGGTGCCAAAAAGGTCATCATCTCGGCTCCCTCGGCCGATGCTCCCATGTACGTC
ATGGGTGTTAATGAGAAGACGTACGACGGCAAGGCCGATGTCATCTCCAACGCCTCATGCACCACCAACTGCCTC
GCCCCGCTCGCAAAGGTCATCCACGACAACTTTGGCATCGTCGAGGGTCTCATGACCACTATCCACTCCTATACG
GCCACGCAAAAGACGGTTGACGGCCCCTCAGCCAAGGACTGGCGCGGTGGTCGCGGTGCCGCTCAGAACATTATT
CCCAGCAGCACCGGTGCCGCCAAGGCTGTTGGCAAGGTGATTCCCGATCTCAATGGCAAGCTCACAGGCATGTCG
ATGCGTGTCCCCACGGCCAACGTATCCGTCGTCGACCTGACGGTTCGTCTCGAAAAGAGTGCCACCTATGATCAG
ATCAAGGAGGTTGTCAAGAAGTCTGCTGCCGGTCCCCTCAAGGGCATCCTTGACTACACTGAAGATGAAGTCGTT
TCGAGCGACATGAATGGCAACACTGCCTCATCCATTTTTGATGCCAAGGCCGGCATCTCTCTCAACCCCAACTTT
GTCAAGCTCGTCAGCTGGTACGACAACGAATGGGGTTACTCGCGTCGTGTCCTTGATCTCCTCGCCCACATTGCC
AAGACTGATGCTGGTAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail