Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4819
Gene name
LocationContig_415:6185..8255
Strand-
Gene length (bp)2070
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.6E-05 258 324
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.3E-12 377 448
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.0E-05 508 568

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36629|U2AF2_SCHPO Splicing factor U2AF 59 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp2 PE=1 SV=1 178 583 3.0E-71
sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=1 SV=1 187 573 5.0E-68
sp|P90978|U2AF2_CAEEL Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans GN=uaf-1 PE=2 SV=2 164 573 9.0E-61
sp|P90727|U2AF2_CAEBR Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis briggsae GN=uaf-1 PE=3 SV=2 194 573 1.0E-60
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 186 572 1.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36629|U2AF2_SCHPO Splicing factor U2AF 59 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp2 PE=1 SV=1 178 583 3.0E-71
sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=1 SV=1 187 573 5.0E-68
sp|P90978|U2AF2_CAEEL Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans GN=uaf-1 PE=2 SV=2 164 573 9.0E-61
sp|P90727|U2AF2_CAEBR Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis briggsae GN=uaf-1 PE=3 SV=2 194 573 1.0E-60
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 186 572 1.0E-60
sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 186 572 1.0E-60
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 191 578 7.0E-41
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 188 579 2.0E-40
sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 209 578 1.0E-38
sp|Q2R0Q1|U2A2A_ORYSJ Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2 184 578 6.0E-37
sp|Q63285|UHMK1_RAT Serine/threonine-protein kinase Kist OS=Rattus norvegicus GN=Uhmk1 PE=1 SV=1 485 579 1.0E-10
sp|P97343|UHMK1_MOUSE Serine/threonine-protein kinase Kist OS=Mus musculus GN=Uhmk1 PE=1 SV=3 485 579 1.0E-10
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 482 578 1.0E-08
sp|P42698|DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana GN=DRT111 PE=1 SV=2 479 581 4.0E-08
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 365 452 7.0E-07
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 231 572 2.0E-06
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 367 452 2.0E-06
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 367 452 2.0E-06
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 367 452 2.0E-06
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 376 452 3.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 4 139 5.0E-06
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 372 452 6.0E-06
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 481 579 7.0E-06
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 481 579 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4819
MNGDSYSARGADGRRGREYPPNRGDRDERRDRFRDRDRERDRERERDRDRDRDRDRDRDRDRQRDRRRSRSPDHR
VHRRGGDGDADAYSSSRTHRDREREDRYAGRDRRGEREWDRDRGSSRRDARRDDEERPPRRDRELYDERRRAPRE
RRDDVAFARQEQPRRSPTPVKREPTPDLTDTVPILERKRRLTQWDIKPPGYELVTAEQAKLSGMFPLPGAPRQQA
VDPTRLQAFMNQPGAQVTSAGLKASNSRQSKRLIVSNLPPGTTEESLVAFFNLQLNDLNVIESTDPCAYCQFSPD
DTFAVLEFKNAADATMALALDGISMTADDVANGSDMPDASRLVIRRPKDYVMPAVPDDMMYDMDVVSSNVPDTVH
KLCISNLPTYLTEEQVMELLAAFGKPKAFVLVKDRNADESRGIAFVEYFEPTAANDPALNTLNGMDVKGNKLKAN
KASFGFTQVANFDVGITAISGLASQTSGNTEKGRVLQLLNMVKPEELMDNDEYQEICDDVREECVKFGTLLDLKV
PRPSGGSRQSAGVGKIFVKFESSDSAQNALTALAGRKFADRTVVATYFPEENFEVNAW*
Coding >OphauG2|4819
ATGAACGGCGACAGCTACTCAGCTCGAGGTGCAGATGGGCGGCGGGGTCGAGAGTATCCCCCTAATCGAGGGGAT
CGTGACGAGCGTCGAGACCGTTTCCGAGATAGGGACCGAGAGCGTGATCGTGAGCGTGAGCGCGACCGCGACCGC
GACCGCGACCGTGATCGTGACCGTGATCGCGACCGTCAGCGTGACCGCAGACGCTCCAGATCCCCTGATCATCGT
GTCCATCGTCGCGGCGGAGATGGCGATGCCGATGCCTACTCGTCGAGCCGAACTCACCGTGACAGAGAGCGCGAG
GACCGCTACGCCGGCCGTGATCGCCGAGGAGAGCGTGAGTGGGATCGCGATCGAGGCTCTTCTCGCAGAGACGCT
AGGCGCGATGACGAGGAAAGGCCTCCCCGACGCGACAGGGAATTGTACGATGAACGTCGCCGTGCCCCCAGAGAG
CGCCGAGACGACGTGGCCTTTGCGAGACAGGAACAGCCTCGCAGGAGTCCGACTCCTGTTAAGCGCGAGCCGACT
CCTGATCTTACCGACACTGTTCCCATATTGGAGCGTAAAAGACGACTGACCCAATGGGACATCAAACCACCGGGC
TATGAACTAGTCACGGCTGAACAGGCAAAACTTTCTGGAATGTTTCCATTGCCTGGGGCTCCTCGCCAACAAGCT
GTTGACCCGACTCGACTTCAGGCCTTTATGAATCAGCCTGGAGCACAAGTGACTAGTGCAGGCCTCAAGGCAAGC
AACTCGCGACAATCGAAGCGTCTCATCGTCTCAAACTTGCCTCCCGGTACAACGGAAGAGAGCCTTGTCGCCTTC
TTCAATCTACAGCTCAATGACCTCAATGTCATCGAGTCCACCGACCCTTGTGCTTATTGCCAATTTTCTCCAGAC
GATACTTTTGCCGTCTTGGAATTCAAGAACGCTGCAGACGCTACCATGGCTCTCGCTCTTGACGGAATCTCAATG
ACTGCAGACGACGTTGCAAATGGCTCCGACATGCCAGATGCATCCCGTCTCGTCATCCGGCGACCAAAGGACTAC
GTCATGCCCGCTGTCCCTGATGATATGATGTACGACATGGACGTTGTCTCCAGCAACGTTCCCGATACCGTGCAT
AAACTTTGCATCAGCAACCTTCCCACATACCTCACAGAGGAGCAGGTCATGGAACTACTTGCTGCATTTGGCAAA
CCCAAGGCTTTTGTCCTGGTCAAAGATCGCAATGCCGATGAATCGCGAGGTATTGCTTTTGTCGAATACTTTGAA
CCGACTGCAGCAAATGACCCTGCCCTGAACACCTTGAACGGCATGGATGTCAAGGGCAACAAGCTCAAGGCAAAT
AAAGCCAGCTTTGGCTTCACGCAGGTTGCCAACTTTGATGTGGGCATCACAGCCATTAGCGGCCTTGCTTCACAA
ACCTCTGGCAACACGGAAAAGGGGCGTGTGCTACAGCTGCTCAACATGGTCAAACCAGAAGAGCTCATGGACAAC
GACGAATACCAAGAAATTTGTGATGATGTTCGCGAAGAGTGTGTCAAGTTTGGCACCTTGTTGGATCTAAAAGTC
CCCAGGCCCTCGGGAGGCAGTCGCCAGTCTGCTGGCGTGGGCAAGATTTTTGTCAAATTCGAATCAAGCGACTCG
GCCCAGAATGCGCTTACGGCACTAGCTGGCCGCAAGTTTGCCGATCGAACTGTTGTTGCAACTTACTTCCCCGAG
GAAAACTTTGAAGTCAACGCATGGTGA
Transcript >OphauG2|4819
ATGAACGGCGACAGCTACTCAGCTCGAGGTGCAGATGGGCGGCGGGGTCGAGAGTATCCCCCTAATCGAGGGGAT
CGTGACGAGCGTCGAGACCGTTTCCGAGATAGGGACCGAGAGCGTGATCGTGAGCGTGAGCGCGACCGCGACCGC
GACCGCGACCGTGATCGTGACCGTGATCGCGACCGTCAGCGTGACCGCAGACGCTCCAGATCCCCTGATCATCGT
GTCCATCGTCGCGGCGGAGATGGCGATGCCGATGCCTACTCGTCGAGCCGAACTCACCGTGACAGAGAGCGCGAG
GACCGCTACGCCGGCCGTGATCGCCGAGGAGAGCGTGAGTGGGATCGCGATCGAGGCTCTTCTCGCAGAGACGCT
AGGCGCGATGACGAGGAAAGGCCTCCCCGACGCGACAGGGAATTGTACGATGAACGTCGCCGTGCCCCCAGAGAG
CGCCGAGACGACGTGGCCTTTGCGAGACAGGAACAGCCTCGCAGGAGTCCGACTCCTGTTAAGCGCGAGCCGACT
CCTGATCTTACCGACACTGTTCCCATATTGGAGCGTAAAAGACGACTGACCCAATGGGACATCAAACCACCGGGC
TATGAACTAGTCACGGCTGAACAGGCAAAACTTTCTGGAATGTTTCCATTGCCTGGGGCTCCTCGCCAACAAGCT
GTTGACCCGACTCGACTTCAGGCCTTTATGAATCAGCCTGGAGCACAAGTGACTAGTGCAGGCCTCAAGGCAAGC
AACTCGCGACAATCGAAGCGTCTCATCGTCTCAAACTTGCCTCCCGGTACAACGGAAGAGAGCCTTGTCGCCTTC
TTCAATCTACAGCTCAATGACCTCAATGTCATCGAGTCCACCGACCCTTGTGCTTATTGCCAATTTTCTCCAGAC
GATACTTTTGCCGTCTTGGAATTCAAGAACGCTGCAGACGCTACCATGGCTCTCGCTCTTGACGGAATCTCAATG
ACTGCAGACGACGTTGCAAATGGCTCCGACATGCCAGATGCATCCCGTCTCGTCATCCGGCGACCAAAGGACTAC
GTCATGCCCGCTGTCCCTGATGATATGATGTACGACATGGACGTTGTCTCCAGCAACGTTCCCGATACCGTGCAT
AAACTTTGCATCAGCAACCTTCCCACATACCTCACAGAGGAGCAGGTCATGGAACTACTTGCTGCATTTGGCAAA
CCCAAGGCTTTTGTCCTGGTCAAAGATCGCAATGCCGATGAATCGCGAGGTATTGCTTTTGTCGAATACTTTGAA
CCGACTGCAGCAAATGACCCTGCCCTGAACACCTTGAACGGCATGGATGTCAAGGGCAACAAGCTCAAGGCAAAT
AAAGCCAGCTTTGGCTTCACGCAGGTTGCCAACTTTGATGTGGGCATCACAGCCATTAGCGGCCTTGCTTCACAA
ACCTCTGGCAACACGGAAAAGGGGCGTGTGCTACAGCTGCTCAACATGGTCAAACCAGAAGAGCTCATGGACAAC
GACGAATACCAAGAAATTTGTGATGATGTTCGCGAAGAGTGTGTCAAGTTTGGCACCTTGTTGGATCTAAAAGTC
CCCAGGCCCTCGGGAGGCAGTCGCCAGTCTGCTGGCGTGGGCAAGATTTTTGTCAAATTCGAATCAAGCGACTCG
GCCCAGAATGCGCTTACGGCACTAGCTGGCCGCAAGTTTGCCGATCGAACTGTTGTTGCAACTTACTTCCCCGAG
GAAAACTTTGAAGTCAACGCATGGTGA
Gene >OphauG2|4819
ATGAACGGCGACAGCTACTCAGCTCGAGGTTCGCTAATCATGCCACCATGATGGCCAGGGTAGTCGCTGACTTGG
ACGCTCCATCATTTCAAGCAGGTGCAGATGGGCGGCGGGGTCGAGAGTATCCCGTGAGCATACCATGGCGCGTTC
TGCTTGGCTCAAGGCTTCTAACCAGACCATACATTACAGCCTAATCGAGGGGATCGTGACGAGCGTCGAGACCGT
TTCCGAGATAGGGACCGAGAGCGTGATCGTGAGCGTGAGCGCGACCGCGACCGCGACCGCGACCGTGATCGTGAC
CGTGATCGCGACCGTCAGCGTGACCGCAGACGCTCCAGATCCCCTGATCATCGTGTCCATCGTCGCGGCGGAGAT
GGCGATGCCGATGCCTACTCGTCGAGCCGAACTCACCGTGACAGAGAGCGCGAGGACCGCTACGCCGGCCGTGAT
CGCCGAGGAGAGCGTGAGTGGGATCGCGATCGAGGCTCTTCTCGCAGAGACGCTAGGCGCGATGACGAGGAAAGG
CCTCCCCGACGCGACAGGGAATTGTACGATGAACGTCGCCGTGCCCCCAGAGAGCGCCGAGACGACGTGGCCTTT
GCGAGACAGGAACAGCCTCGCAGGAGTCCGACTCCTGTTAAGCGCGAGCCGACTCCTGATCTTACCGACACTGTT
CCCATATTGGAGCGTAAAAGACGACTGACCCAATGGGACATCAAACCACCGGGCTATGAACTAGTCACGGCTGAA
CAGGCAAAACTTTCTGGAATGTTTCCATTGCCTGGGGCTCCTCGCCAACAAGCTGTTGACCCGACTCGACTTCAG
GCCTTTATGAATCAGCCTGGAGCACAAGTGACTAGTGCAGGCCTCAAGGCAAGCAACTCGCGACAATCGAAGCGT
CTCATCGTCTCAAACTTGCCTCCCGGTACAACGGAAGAGAGCCTTGTCGCCTTCTTCAATCTACAGCTCAATGAC
CTCAATGTCATCGAGTCCACCGACCCTTGTGCTTATTGCCAATTTTCTCCAGACGATACTTTTGCCGTCTTGGAA
TTCAAGAACGCTGCAGACGCTACCATGGCTCTCGCTCTTGACGGAATCTCAATGACTGCAGACGACGTTGCAAAT
GGCTCCGACATGCCAGATGCATCCCGTCTCGTCATCCGGCGACCAAAGGACTACGTCATGCCCGCTGTCCCTGAT
GATATGATGTACGACATGGACGTTGTCTCCAGCAACGTTCCCGATACCGTGCATAAACTTTGCATCAGCAACCTT
CCCACATACCTCACAGAGGAGCAGGTCATGGAACTACTTGCTGCATTTGGCAAACCCAAGGCTTTTGTCCTGGTC
AAAGATCGCAATGCCGATGAATCGCGAGTAAGGAGACTGGTCCTTGTCATGCTGTGTTTTGAGCCATGCATGATT
AGATTTACTAACTTGTCAAGGGTATTGCTTTTGTCGAATACTTTGAACCGACTGCAGCAAATGACCCTGCCCTGA
ACACCTTGAACGGCATGGATGTCAAGGGCAACAAGCTCAAGGCAAATAAAGCCAGCTTTGGCTTCACGCAGGTTG
CCAACTTTGATGTGGGCATCACAGCCATTAGCGGCCTTGCTTCACAAACCTCTGGCAACACGGAAAAGGGGCGTG
TGCTACAGCTGCTCAACATGGTCAAACCAGAAGAGCTCATGGACAACGACGAATACCAAGGTAGGTCACGCAAAA
GCGTGAGCACTCACCCAGGTTAGTCCACACTTGTGCTGACAAGCCAATAGAAATTTGTGATGATGTTCGCGAAGA
GTGTGTCAAGTTTGGCACCTTGTTGGATCTAAAAGTCCCCAGGCCCTCGGGAGGCAGTCGCCAGTCTGCTGGCGT
GGGCAAGATTTTTGTCAAATTCGAATCAAGCGACTCGGCCCAGAATGCGCTTACGGCACTAGCTGGCCGCAAGTT
TGCCGATCGAACTGTTGTTGCAACTTACTTCCCCGAGGTCAGATTGGTTACCATGCTTGTGAGACGTTTGTGCAC
ATGCTAACACTGGCGCAGGAAAACTTTGAAGTCAACGCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail