Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4810
Gene name
LocationContig_413:13551..16106
Strand+
Gene length (bp)2555
Transcript length (bp)2394
Coding sequence length (bp)2394
Protein length (aa) 798

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12090 Spt20 Spt20 family 9.0E-32 141 391

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14174|SPT20_SCHPO SAGA complex subunit spt20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt20 PE=1 SV=1 135 210 4.0E-15
sp|Q5A2B9|SPT20_CANAL Transcription factor SPT20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT20 PE=1 SV=1 128 224 9.0E-10

GO

GO Term Description Terminal node
GO:0000124 SAGA complex Yes
GO:0003712 transcription coregulator activity Yes
GO:0140110 transcription regulator activity No
GO:0003674 molecular_function No
GO:0070461 SAGA-type complex No
GO:1990234 transferase complex No
GO:0140535 intracellular protein-containing complex No
GO:0031248 protein acetyltransferase complex No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:1902493 acetyltransferase complex No
GO:0005575 cellular_component No
GO:1902494 catalytic complex No
GO:1905368 peptidase complex No
GO:0000123 histone acetyltransferase complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5287
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4810 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1521
Ophiocordyceps camponoti-floridani Ophcf2|03682
Ophiocordyceps camponoti-rufipedis Ophun1|4225
Ophiocordyceps kimflemingae Ophio5|6081
Ophiocordyceps subramaniannii Hirsu2|4717

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4810
MAPGSPVTSLSGAPKTKTPVPPRAQANGGPVPGGPSSSPSPSLSSRKPPPPPLRQTPTSAGGDHSITIATSTVRP
ASRPVRRDAPVPSTGPGASAPQTSGRTSRNSAGMRLTSIPGDTNSRLTEPLPYLVTDSYILNKFARHKPSLVVHL
YPTHFRFDSQDGIFPYKSPMKIFLEHLKSHTVPHDLLEYLHQYDVPFYDDRLIVQVLDHKMVAAMNKDASSESKK
APLLSMTAAPASINNYNQYLTPSPFASYQKEDQNKPGMNANDDKSSKDKANENGSSSIPVVGETGQAKSGGPQGP
RKYTLVLHPTAESLQAELRIKAAAASKISTEGKGNSDGAAVQQPSTPMSLAPQTPSVANMPPPAKAQMLLKAHPQ
LYLRPSKSVEETIALMDFFRHPDHSAPPPKPKTRKRTRAEMAADEAAAAEHQRFMLCMDDKMTSTAGQNGSGSDA
DAQTSATDFEPRFGRFKLIEDLRRDQAEKEQEKLKQQDADKRAQQVEAERRVQQQQQQQEMDRRHMQRQQELFQQ
QRQQADAEKARGEAASNREMQMRMEQTQRQVMARRTPAPGANNNQNGQGAAPGPMAHHGHGVQCMNMSVGASNGI
AGAGPNAMANAVQGQGQAQPRFQTQMSQGQASSPVVQQGTPQQNMSSPMASVPMQQTNSAVAGSPPRPSPDVQSV
QQLTVPMAHSMSARGSQQSNPSGTPRGPNATPNLAHGTPINRQAMTATPRMTQASPPPNMMAQGSQMGHQAIMMN
QQGMNPHNQIYAQMAAANQHRVMAQQQQHLAAMQNGNSNLVMNGAHS*
Coding >OphauG2|4810
ATGGCGCCCGGCAGTCCCGTCACTTCGCTCTCGGGGGCGCCCAAAACAAAGACTCCAGTCCCCCCCCGTGCTCAG
GCCAACGGCGGGCCTGTCCCGGGGGGCCCTTCATCATCGCCTTCGCCTTCGCTATCATCTAGAAAGCCACCTCCG
CCGCCGCTGCGACAAACACCAACTTCGGCTGGCGGCGACCATTCCATAACCATTGCTACTTCCACCGTCCGCCCT
GCCAGTCGTCCTGTGCGTCGCGATGCCCCTGTGCCATCTACCGGGCCTGGGGCCTCGGCGCCTCAGACCTCTGGG
AGGACTTCACGCAACAGCGCTGGAATGCGTTTGACGTCGATACCAGGAGACACCAATTCTCGCTTGACTGAGCCT
CTCCCGTACCTTGTGACCGACTCGTATATCCTCAACAAGTTTGCCCGTCACAAACCATCGCTCGTTGTTCACCTA
TATCCAACCCACTTTCGGTTCGACAGCCAAGACGGCATATTCCCCTATAAATCCCCAATGAAGATTTTCCTTGAG
CACCTCAAATCCCACACCGTTCCCCACGATCTTCTTGAGTATCTGCACCAGTACGACGTGCCTTTTTACGATGAC
CGCCTCATAGTCCAAGTCTTGGACCATAAGATGGTGGCAGCCATGAATAAGGATGCCTCGTCAGAGTCCAAAAAG
GCGCCGCTTTTGTCCATGACTGCAGCTCCCGCGTCAATAAACAACTACAACCAATATTTAACCCCCTCGCCTTTT
GCTTCCTATCAAAAAGAGGATCAAAACAAGCCTGGGATGAATGCCAACGACGACAAGAGCTCCAAGGACAAGGCC
AACGAAAATGGTTCATCGTCTATTCCAGTCGTCGGCGAAACGGGCCAAGCCAAGAGCGGAGGGCCCCAAGGGCCC
AGAAAATATACCCTTGTTCTACATCCCACGGCAGAGAGCTTACAAGCAGAATTGCGTATCAAGGCTGCCGCCGCG
TCAAAAATCTCAACTGAAGGAAAAGGAAACTCGGATGGGGCCGCGGTACAACAGCCCTCAACTCCAATGTCGTTG
GCCCCTCAAACACCTTCAGTAGCAAATATGCCACCCCCTGCTAAGGCTCAGATGCTCCTCAAAGCCCATCCCCAA
CTATACCTCAGGCCCTCGAAAAGTGTTGAAGAGACAATTGCTCTCATGGATTTCTTTCGTCATCCTGATCACTCA
GCGCCTCCTCCCAAGCCCAAGACACGAAAGCGAACTCGAGCCGAAATGGCGGCTGATGAGGCGGCCGCTGCTGAG
CACCAGCGATTCATGCTTTGCATGGATGATAAGATGACAAGCACGGCAGGCCAAAACGGTAGTGGCTCAGACGCG
GATGCTCAAACAAGTGCAACGGACTTTGAGCCTAGGTTTGGCCGGTTCAAGCTCATTGAAGATCTGCGTAGAGAC
CAAGCAGAGAAGGAGCAGGAGAAGCTGAAGCAACAGGATGCCGACAAGAGAGCGCAGCAGGTAGAGGCGGAGCGC
AGAGTCCAGCAGCAGCAGCAGCAGCAAGAGATGGACCGAAGACACATGCAGAGGCAGCAGGAACTCTTCCAGCAG
CAGAGACAGCAGGCTGATGCTGAAAAGGCCCGAGGCGAAGCAGCCTCGAATCGCGAAATGCAGATGCGCATGGAG
CAGACGCAACGCCAGGTCATGGCTCGCCGAACCCCTGCGCCAGGCGCCAACAATAACCAAAACGGCCAGGGAGCG
GCACCGGGTCCCATGGCCCATCATGGGCATGGCGTACAGTGTATGAACATGTCTGTCGGCGCATCAAACGGCATC
GCTGGGGCTGGTCCAAACGCCATGGCCAACGCTGTACAAGGCCAAGGACAGGCGCAGCCTAGATTCCAGACCCAA
ATGTCGCAGGGCCAGGCGTCGTCTCCCGTCGTGCAACAGGGAACTCCGCAGCAAAACATGTCGTCGCCAATGGCC
AGCGTGCCCATGCAGCAGACCAACTCGGCTGTGGCTGGCAGTCCGCCTCGGCCGTCGCCAGACGTTCAGAGCGTC
CAGCAGTTGACGGTGCCCATGGCTCACAGCATGTCGGCCAGGGGTAGCCAGCAGAGCAATCCCTCTGGGACGCCT
CGGGGACCCAATGCTACCCCCAACCTTGCGCACGGGACGCCCATTAATCGCCAGGCCATGACTGCAACGCCGCGC
ATGACGCAGGCCAGTCCACCGCCCAACATGATGGCGCAGGGCTCGCAGATGGGCCATCAAGCCATCATGATGAAT
CAACAAGGCATGAATCCTCACAATCAAATATACGCCCAGATGGCTGCGGCGAATCAGCATCGAGTCATGGCTCAG
CAGCAGCAGCACCTCGCCGCCATGCAAAACGGCAACTCCAACTTGGTGATGAACGGAGCCCACAGCTGA
Transcript >OphauG2|4810
ATGGCGCCCGGCAGTCCCGTCACTTCGCTCTCGGGGGCGCCCAAAACAAAGACTCCAGTCCCCCCCCGTGCTCAG
GCCAACGGCGGGCCTGTCCCGGGGGGCCCTTCATCATCGCCTTCGCCTTCGCTATCATCTAGAAAGCCACCTCCG
CCGCCGCTGCGACAAACACCAACTTCGGCTGGCGGCGACCATTCCATAACCATTGCTACTTCCACCGTCCGCCCT
GCCAGTCGTCCTGTGCGTCGCGATGCCCCTGTGCCATCTACCGGGCCTGGGGCCTCGGCGCCTCAGACCTCTGGG
AGGACTTCACGCAACAGCGCTGGAATGCGTTTGACGTCGATACCAGGAGACACCAATTCTCGCTTGACTGAGCCT
CTCCCGTACCTTGTGACCGACTCGTATATCCTCAACAAGTTTGCCCGTCACAAACCATCGCTCGTTGTTCACCTA
TATCCAACCCACTTTCGGTTCGACAGCCAAGACGGCATATTCCCCTATAAATCCCCAATGAAGATTTTCCTTGAG
CACCTCAAATCCCACACCGTTCCCCACGATCTTCTTGAGTATCTGCACCAGTACGACGTGCCTTTTTACGATGAC
CGCCTCATAGTCCAAGTCTTGGACCATAAGATGGTGGCAGCCATGAATAAGGATGCCTCGTCAGAGTCCAAAAAG
GCGCCGCTTTTGTCCATGACTGCAGCTCCCGCGTCAATAAACAACTACAACCAATATTTAACCCCCTCGCCTTTT
GCTTCCTATCAAAAAGAGGATCAAAACAAGCCTGGGATGAATGCCAACGACGACAAGAGCTCCAAGGACAAGGCC
AACGAAAATGGTTCATCGTCTATTCCAGTCGTCGGCGAAACGGGCCAAGCCAAGAGCGGAGGGCCCCAAGGGCCC
AGAAAATATACCCTTGTTCTACATCCCACGGCAGAGAGCTTACAAGCAGAATTGCGTATCAAGGCTGCCGCCGCG
TCAAAAATCTCAACTGAAGGAAAAGGAAACTCGGATGGGGCCGCGGTACAACAGCCCTCAACTCCAATGTCGTTG
GCCCCTCAAACACCTTCAGTAGCAAATATGCCACCCCCTGCTAAGGCTCAGATGCTCCTCAAAGCCCATCCCCAA
CTATACCTCAGGCCCTCGAAAAGTGTTGAAGAGACAATTGCTCTCATGGATTTCTTTCGTCATCCTGATCACTCA
GCGCCTCCTCCCAAGCCCAAGACACGAAAGCGAACTCGAGCCGAAATGGCGGCTGATGAGGCGGCCGCTGCTGAG
CACCAGCGATTCATGCTTTGCATGGATGATAAGATGACAAGCACGGCAGGCCAAAACGGTAGTGGCTCAGACGCG
GATGCTCAAACAAGTGCAACGGACTTTGAGCCTAGGTTTGGCCGGTTCAAGCTCATTGAAGATCTGCGTAGAGAC
CAAGCAGAGAAGGAGCAGGAGAAGCTGAAGCAACAGGATGCCGACAAGAGAGCGCAGCAGGTAGAGGCGGAGCGC
AGAGTCCAGCAGCAGCAGCAGCAGCAAGAGATGGACCGAAGACACATGCAGAGGCAGCAGGAACTCTTCCAGCAG
CAGAGACAGCAGGCTGATGCTGAAAAGGCCCGAGGCGAAGCAGCCTCGAATCGCGAAATGCAGATGCGCATGGAG
CAGACGCAACGCCAGGTCATGGCTCGCCGAACCCCTGCGCCAGGCGCCAACAATAACCAAAACGGCCAGGGAGCG
GCACCGGGTCCCATGGCCCATCATGGGCATGGCGTACAGTGTATGAACATGTCTGTCGGCGCATCAAACGGCATC
GCTGGGGCTGGTCCAAACGCCATGGCCAACGCTGTACAAGGCCAAGGACAGGCGCAGCCTAGATTCCAGACCCAA
ATGTCGCAGGGCCAGGCGTCGTCTCCCGTCGTGCAACAGGGAACTCCGCAGCAAAACATGTCGTCGCCAATGGCC
AGCGTGCCCATGCAGCAGACCAACTCGGCTGTGGCTGGCAGTCCGCCTCGGCCGTCGCCAGACGTTCAGAGCGTC
CAGCAGTTGACGGTGCCCATGGCTCACAGCATGTCGGCCAGGGGTAGCCAGCAGAGCAATCCCTCTGGGACGCCT
CGGGGACCCAATGCTACCCCCAACCTTGCGCACGGGACGCCCATTAATCGCCAGGCCATGACTGCAACGCCGCGC
ATGACGCAGGCCAGTCCACCGCCCAACATGATGGCGCAGGGCTCGCAGATGGGCCATCAAGCCATCATGATGAAT
CAACAAGGCATGAATCCTCACAATCAAATATACGCCCAGATGGCTGCGGCGAATCAGCATCGAGTCATGGCTCAG
CAGCAGCAGCACCTCGCCGCCATGCAAAACGGCAACTCCAACTTGGTGATGAACGGAGCCCACAGCTGA
Gene >OphauG2|4810
ATGGCGCCCGGCAGTCCCGTCACTTCGCTCTCGGGGGCGCCCAAAACAAAGACTCCAGTCCCCCCCCGTGCTCAG
GCCAACGGCGGGCCTGTCCCGGGGGGCCCTTCATCATCGCCTTCGCCTTCGCTATCATCTAGAAAGCCACCTCCG
CCGCCGCTGCGACAAACACCAACTTCGGCTGGCGGCGACCATTCCATAACCATTGCTACTTCCACCGTCCGCCCT
GCCAGTCGTCCTGTGCGTCGCGATGCCCCTGTGCCATCTACCGGGCCTGGGGCCTCGGCGCCTCAGACCTCTGGG
AGGACTTCACGCAACAGCGCTGGAATGCGTTTGACGTCGATACCAGGAGACACCAATTCTCGCTTGACTGAGCCT
CTCCCGTACCGTGAGTTTCCCATATCCATTGCGTCCTGTAGCACTCTTGCTGACAGGCCGCGCAGTTGTGACCGA
CTCGTATATCCTCAACAAGTTTGCCCGTCACAAACCATCGCTCGTTGTTCACCTATATCCAACCCACTTTCGGTT
CGACAGCCAAGACGGCATATTCCCCTATAAATCCCCAATGAAGATTTTCCTTGAGCACCTCAAATCCCACACCGT
TCCCCACGATCTTCTTGAGTATCTGCACCAGTACGACGTGCCTTTTTACGATGACCGCCTCATAGTCCAAGTCTT
GGACCATAAGATGGTGGCAGCCATGAATAAGGATGCCTCGTCAGAGTCCAAAAAGGCGCCGCTTTTGTCCATGAC
TGCAGCTCCCGCGTCAATAAACAACTACAACCAATATTTAACCCCCTCGCCTTTTGCTTCCTATCAAAAAGAGGA
TCAAAACAAGCCTGGGATGAATGCCAACGACGACAAGAGCTCCAAGGACAAGGCCAACGAAAATGGTTCATCGTC
TATTCCAGTCGTCGGCGAAACGGGCCAAGCCAAGAGCGGAGGGCCCCAAGGGCCCAGAAAATATACCCTTGTTCT
ACATCCCACGGCAGAGAGCTTACAAGCAGAATTGCGTATCAAGGCTGCCGCCGCGTCAAAAATCTCAACTGAAGG
AAAAGGAAACTCGGATGGGGCCGCGGTACAACAGCCCTCAACTCCAATGTCGTTGGCCCCTCAAACACCTTCAGT
AGCAAATATGCCACCCCCTGCTAGTAAGCCAGCCCCTTCAAAGGAGCAGTGTGATGGTACTAGCATCAGGGACCT
AGAGGCTCAGATGCTCCTCAAAGCCCATCCCCAACTATACCTCAGGCCCTCGAAAAGTGTTGAAGAGACAATTGC
TCTCATGGATTTCTTTCGTCATCCTGATCACTCAGCGCCTCCTCCCAAGCCCAAGACACGAAAGCGAACTCGAGC
CGAAATGGCGGCTGATGAGGCGGCCGCTGCTGAGCACCAGCGATTCATGCTTTGCATGGATGATAAGATGACAAG
CACGGCAGGCCAAAACGGTAGTGGCTCAGACGCGGATGCTCAAACAAGTGCAACGGACTTTGAGCCTAGGTTTGG
CCGGTTCAAGCTCATTGAAGATCTGCGTAGAGACCAAGCAGAGAAGGAGCAGGAGAAGCTGAAGCAACAGGATGC
CGACAAGAGAGCGCAGCAGGTAGAGGCGGAGCGCAGAGTCCAGCAGCAGCAGCAGCAGCAAGAGATGGACCGAAG
ACACATGCAGAGGCAGCAGGAACTCTTCCAGCAGCAGAGACAGCAGGCTGATGCTGAAAAGGCCCGAGGCGAAGC
AGCCTCGAATCGCGAAATGCAGATGCGCATGGAGCAGACGCAACGCCAGGTCATGGCTCGCCGAACCCCTGCGCC
AGGCGCCAACAATAACCAAAACGGCCAGGGAGCGGCACCGGGTCCCATGGCCCATCATGGGCATGGCGTACAGTG
TATGAACATGTCTGTCGGCGCATCAAACGGCATCGCTGGGGCTGGTCCAAACGCCATGGCCAACGCTGTACAAGG
CCAAGGACAGGCGCAGCCTAGATTCCAGACCCAAATGTCGCAGGGCCAGGCGTCGTCTCCCGTCGTGCAACAGGG
AACTCCGCAGCAAAACATGTCGTCGCCAATGGCCAGCGTGCCCATGCAGCAGACCAACTCGGCTGTGGCTGGCAG
TCCGCCTCGGCCGTCGCCAGACGTTCAGAGCGTCCAGCAGTTGACGGTGCCCATGGCTCACAGCATGTCGGCCAG
GGGTAGCCAGCAGAGCAATCCCTCTGGGACGCCTCGGGGACCCAATGCTACCCCCAACCTTGCGCACGGGACGCC
CATTAATCGCCAGGCCATGACTGCAACGCCGCGCATGACGCAGGCCAGTCCACCGCCCAACATGATGGCGCAGGG
CTCGCAGATGGGCCATCAAGCCATCATGATGAATCAACAAGGCATGAATCCTCACAATCAAATATACGCCCAGAT
GGCTGCGGCGAATCAGCATCGAGTCATGGCTCAGCAGCAGCAGCACCTCGCCGCCATGCAAAACGGCAACTCCAA
CTTGGTGATGAACGGAGCCCAGTCCATGTCGCCACAGCAGCAGCAGCAAATCCCACAGGCCCATGTTATGCAGCA
GCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail