Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4806
Gene name
LocationContig_412:11063..13677
Strand-
Gene length (bp)2614
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 98 115 17
2 128 145 17
3 160 182 22
4 191 213 22
5 223 245 22
6 258 280 22
7 285 307 22
8 328 350 22
9 501 523 22
10 535 557 22
11 567 589 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4806
MPSSSESDTQHRAEKLRFFTSPVVRRASGNGTPNSPSWASPTTKPSKVENQKFKGTPELQRHQEPTLLEIFYDLF
FAANYNTFTDTQQATNKARFKAYTGYFCLLWLTWFLVTLYDVRYVTDSVFARITRAIQLGVLVGFAVVAPKFDST
TQHFETMRTMSLILMFSRICLAVEYASTLWHVRKWPKARMPLCLQIALHSVAAALYLGVTFAFKRGLRSRAFMAW
YLMSGIEGVASVLLSNLSPILSLTWTHLMKRMTLLTVMIMGDGIVQVAKEVVTIVKNVDAWNATTIGLVTSAVAT
IYFVFLVYFDWLRASFHLPAWRQQLWTSLHLPFHLALVLFTQGFTQLLIWGKINDMQKLAGRAFDRESDLWLPNT
TTAQVQQHWRENVMRFFQDYPPNIEGTLDIVNNSIANLSSIPNHFWYDVAAFDSTLNETLLDQEDEASMETYFTV
LENLLSAMSNALSTAFGIDLSSEVKDKHPDRDIRTGSFQVQISFKGSERYSLVVSSTFLAAAATVFFLVALTVIA
RTTPHKKWPILRLIIIGLLGLTMGLIAIIAAVSDAMSSFVDSAWVMPSITIFWTIILILTHINGEGIRRNAHIFG
ARRRAHDTDAYAPISLPLTPMHTWSPQDDKSLVHQENTSDSLPRGPAHAWPSHGSPTVASVENRQPWLAIKDKSR
NHHAKQ*
Coding >OphauG2|4806
ATGCCTTCTTCATCCGAGTCAGACACTCAGCATCGCGCTGAGAAGCTGCGCTTCTTCACCAGCCCTGTGGTGCGT
CGGGCCAGCGGCAATGGCACCCCCAATTCTCCCAGTTGGGCCTCGCCGACGACCAAGCCAAGTAAAGTGGAAAAT
CAAAAGTTCAAGGGCACGCCCGAGTTGCAGCGTCATCAAGAGCCGACGCTGCTGGAAATCTTTTACGATCTCTTC
TTCGCCGCAAACTACAACACCTTTACCGACACGCAGCAGGCCACAAACAAGGCTCGCTTCAAGGCCTACACTGGC
TATTTTTGCCTGCTGTGGCTAACGTGGTTTCTCGTCACCCTCTACGACGTGCGCTATGTTACCGACAGTGTCTTT
GCACGCATCACGCGCGCCATTCAGCTCGGCGTTTTGGTGGGCTTTGCTGTTGTTGCTCCCAAATTCGACTCTACC
ACGCAGCATTTTGAGACGATGCGAACCATGTCCCTCATTCTCATGTTTTCGCGCATCTGTCTGGCAGTCGAATAC
GCTTCTACACTGTGGCATGTGAGAAAGTGGCCCAAGGCTCGAATGCCTCTGTGCCTCCAGATTGCCCTTCACTCC
GTCGCCGCAGCCCTCTATCTCGGCGTCACGTTTGCCTTTAAAAGGGGGCTTCGCAGCCGCGCATTCATGGCATGG
TACTTGATGTCTGGAATCGAGGGCGTTGCCTCGGTTCTCTTGTCCAATCTGTCGCCCATTCTCAGCCTGACGTGG
ACCCATCTCATGAAGCGCATGACGCTCCTGACAGTCATGATTATGGGCGACGGCATTGTCCAAGTGGCCAAAGAG
GTGGTGACGATTGTCAAGAATGTTGATGCATGGAATGCAACAACCATTGGCCTCGTCACATCAGCCGTGGCCACC
ATTTACTTCGTCTTCCTCGTCTACTTTGACTGGCTACGCGCCTCCTTCCACCTGCCCGCCTGGCGTCAACAGCTC
TGGACCAGCCTCCACCTCCCCTTCCACCTCGCCCTGGTTCTCTTCACCCAGGGCTTCACCCAACTCCTCATCTGG
GGCAAGATTAACGACATGCAAAAGCTTGCCGGGCGCGCCTTTGACCGCGAAAGCGACCTCTGGCTCCCCAATACC
ACGACGGCCCAGGTTCAACAACACTGGCGAGAAAATGTCATGCGCTTCTTCCAAGATTACCCGCCCAATATTGAG
GGCACGCTCGACATTGTGAATAATTCAATTGCTAATTTGTCGTCGATTCCAAATCACTTTTGGTATGATGTCGCC
GCTTTTGATTCGACGCTCAACGAGACCCTTCTTGATCAAGAGGACGAGGCTTCCATGGAAACCTACTTTACCGTG
CTCGAAAACCTTTTGAGCGCCATGTCCAATGCCCTCTCCACCGCATTCGGCATCGACTTGTCCAGCGAGGTCAAG
GACAAGCACCCCGACAGAGACATCAGGACCGGCTCTTTTCAAGTCCAAATCAGCTTCAAGGGGTCTGAGCGCTAT
AGCCTCGTGGTCTCTTCCACCTTTCTCGCCGCTGCCGCCACCGTCTTCTTCCTCGTCGCTCTCACCGTCATTGCC
CGCACGACGCCCCACAAGAAATGGCCCATTCTCCGCCTCATCATCATTGGCTTGCTTGGTCTCACCATGGGCCTC
ATTGCCATCATTGCCGCAGTCTCGGATGCCATGTCCTCCTTTGTCGATTCGGCGTGGGTCATGCCATCCATCACA
ATCTTCTGGACCATTATCCTCATCCTCACGCACATCAATGGCGAAGGCATCCGCCGCAATGCGCACATCTTTGGT
GCCCGCCGTCGCGCCCATGACACAGACGCTTATGCCCCCATTTCTCTTCCACTTACTCCCATGCACACCTGGTCT
CCTCAGGATGACAAGTCCCTTGTCCATCAAGAAAACACCTCGGACTCTCTGCCTCGGGGCCCTGCCCACGCCTGG
CCTAGCCATGGATCGCCAACAGTGGCCTCTGTAGAGAACAGACAACCATGGTTGGCCATCAAGGACAAATCCCGA
AATCACCATGCCAAGCAGTAA
Transcript >OphauG2|4806
ATGCCTTCTTCATCCGAGTCAGACACTCAGCATCGCGCTGAGAAGCTGCGCTTCTTCACCAGCCCTGTGGTGCGT
CGGGCCAGCGGCAATGGCACCCCCAATTCTCCCAGTTGGGCCTCGCCGACGACCAAGCCAAGTAAAGTGGAAAAT
CAAAAGTTCAAGGGCACGCCCGAGTTGCAGCGTCATCAAGAGCCGACGCTGCTGGAAATCTTTTACGATCTCTTC
TTCGCCGCAAACTACAACACCTTTACCGACACGCAGCAGGCCACAAACAAGGCTCGCTTCAAGGCCTACACTGGC
TATTTTTGCCTGCTGTGGCTAACGTGGTTTCTCGTCACCCTCTACGACGTGCGCTATGTTACCGACAGTGTCTTT
GCACGCATCACGCGCGCCATTCAGCTCGGCGTTTTGGTGGGCTTTGCTGTTGTTGCTCCCAAATTCGACTCTACC
ACGCAGCATTTTGAGACGATGCGAACCATGTCCCTCATTCTCATGTTTTCGCGCATCTGTCTGGCAGTCGAATAC
GCTTCTACACTGTGGCATGTGAGAAAGTGGCCCAAGGCTCGAATGCCTCTGTGCCTCCAGATTGCCCTTCACTCC
GTCGCCGCAGCCCTCTATCTCGGCGTCACGTTTGCCTTTAAAAGGGGGCTTCGCAGCCGCGCATTCATGGCATGG
TACTTGATGTCTGGAATCGAGGGCGTTGCCTCGGTTCTCTTGTCCAATCTGTCGCCCATTCTCAGCCTGACGTGG
ACCCATCTCATGAAGCGCATGACGCTCCTGACAGTCATGATTATGGGCGACGGCATTGTCCAAGTGGCCAAAGAG
GTGGTGACGATTGTCAAGAATGTTGATGCATGGAATGCAACAACCATTGGCCTCGTCACATCAGCCGTGGCCACC
ATTTACTTCGTCTTCCTCGTCTACTTTGACTGGCTACGCGCCTCCTTCCACCTGCCCGCCTGGCGTCAACAGCTC
TGGACCAGCCTCCACCTCCCCTTCCACCTCGCCCTGGTTCTCTTCACCCAGGGCTTCACCCAACTCCTCATCTGG
GGCAAGATTAACGACATGCAAAAGCTTGCCGGGCGCGCCTTTGACCGCGAAAGCGACCTCTGGCTCCCCAATACC
ACGACGGCCCAGGTTCAACAACACTGGCGAGAAAATGTCATGCGCTTCTTCCAAGATTACCCGCCCAATATTGAG
GGCACGCTCGACATTGTGAATAATTCAATTGCTAATTTGTCGTCGATTCCAAATCACTTTTGGTATGATGTCGCC
GCTTTTGATTCGACGCTCAACGAGACCCTTCTTGATCAAGAGGACGAGGCTTCCATGGAAACCTACTTTACCGTG
CTCGAAAACCTTTTGAGCGCCATGTCCAATGCCCTCTCCACCGCATTCGGCATCGACTTGTCCAGCGAGGTCAAG
GACAAGCACCCCGACAGAGACATCAGGACCGGCTCTTTTCAAGTCCAAATCAGCTTCAAGGGGTCTGAGCGCTAT
AGCCTCGTGGTCTCTTCCACCTTTCTCGCCGCTGCCGCCACCGTCTTCTTCCTCGTCGCTCTCACCGTCATTGCC
CGCACGACGCCCCACAAGAAATGGCCCATTCTCCGCCTCATCATCATTGGCTTGCTTGGTCTCACCATGGGCCTC
ATTGCCATCATTGCCGCAGTCTCGGATGCCATGTCCTCCTTTGTCGATTCGGCGTGGGTCATGCCATCCATCACA
ATCTTCTGGACCATTATCCTCATCCTCACGCACATCAATGGCGAAGGCATCCGCCGCAATGCGCACATCTTTGGT
GCCCGCCGTCGCGCCCATGACACAGACGCTTATGCCCCCATTTCTCTTCCACTTACTCCCATGCACACCTGGTCT
CCTCAGGATGACAAGTCCCTTGTCCATCAAGAAAACACCTCGGACTCTCTGCCTCGGGGCCCTGCCCACGCCTGG
CCTAGCCATGGATCGCCAACAGTGGCCTCTGTAGAGAACAGACAACCATGGTTGGCCATCAAGGACAAATCCCGA
AATCACCATGCCAAGCAGTAA
Gene >OphauG2|4806
ATGCCTTCTTCATCCGAGTCAGACACTCAGCATCGCGCTGAGAAGCTGCGCTTCTTCACCAGCCCTGTGGTGCGT
CGGGCCAGCGGCAATGGCACCCCCAATTCTCCCAGTTGGGCCTCGCCGACGACCAAGCCAAGTAAAGTGGAAAAT
CAAAAGTTCAAGGGCACGCCCGAGTTGCAGCGTGTTGGTGGTCCGACTCTGTGGCTTGTCAGTGGCCTTGGGTTG
CTAATGCCGGCATTGTAGCATCAAGAGCCGACGCTGCTGGAAATCTTTTACGATCTCTTCTTCGCCGCAAACTAC
AACACCTTTACCGACACGCAGCAGGCCACAAACAAGGCTCGCTTCAAGGCCTACACTGGCTATTTTTGCCTGCTG
TGGCTAACGTGGTTTCTCGTCACCCTCTACGACGTGCGCTATGTTACCGACAGTGTCTTTGGTGCGCTTGCTGCG
TTTGCCTCAATCATTGGCCAGGCAACTGACATCAATTCAAGCACGCATCACGCGCGCCATTCAGCTCGGCGTTTT
GGTGGGCTTTGCTGTTGTTGCTCCCAAATTCGACTCTACCACGCAGCATTTTGAGACGATGCGAACCATGTGTAC
GTCTCTGTCTTGATCTGTCTCTTTTTCTGTCCATCTGTCTCCCTCTCACTTATTGTTTCATTTCTTCATGCATTT
GTTTTTTCAAAGAAAACACCATGACCGCGCCGACACTGACAAACACCCAGCCCTCATTCTCATGTTTTCGCGCAT
CTGTCTGGCAGTCGAATACGCTTCTACACTGTGGCATGTGAGAAAGTGGCCCAAGGCTCGAATGCCTCTGTGCCT
CCAGATTGCCCTTCACTCCGTCGCCGCAGCCCTCTATCTCGGCGTCACGTTTGCCTTTAAAAGGGGGCTTCGCAG
CCGCGCATTCATGGCATGGTACTTGATGTCTGGAATCGAGGGCGTTGCCTCGGTTCTCTTGTCCAATCTGTCGCC
CATTCTCAGCCTGACGTGGACCCATCTCATGAAGCGCATGACGCTCCTGACAGTCATGATTATGGGCGACGGCAT
TGTCCAAGTGGCCAAAGAGGTGGTGACGATTGTCAAGAATGTTGATGCATGGAGTGAGTCGAGTCTTGCTGTACC
TTGGAATTGCTTCGTCGTGTCTTGATTCTATGTCCAACAATTTTATCCAGCGCATACTAAGCAAAGTCGCCCAAC
GCCTAGATGCAACAACCATTGGCCTCGTCACATCAGCCGTGGCCACCATTTACTTCGTCTTCCTCGTCTACTTTG
ACTGGCTACGCGCCTCCTTCCACCTGCCCGCCTGGCGTCAACAGCTCTGGACCAGCCTCCACCTCCCCTTCCACC
TCGCCCTGGTTCTCTTCACCCAGGGCTTCACCCAACTCCTCATCTGGGGCAAGATTAACGACATGCAAAAGCTTG
CCGGGCGCGCCTTTGACCGCGAAAGCGACCTCTGGCTCCCCAATACCACGACGGCCCAGGTTCAACAACACTGGC
GAGAAAATGTCATGCGCTTCTTCCAAGATTACCCGCCCAATATTGAGGGCACGCTCGACATTGTGAATAATTCAA
TTGCTAATTTGTCGTCGATTCCAAATCACTTTTGGTATGATGTCGCCGCTTTTGATTCGACGCTCAACGAGACCC
TTCTTGATCAAGAGGACGAGGCTTCCATGGAAACCTACTTTACCGTGCTCGAAAACCTTTTGAGCGCCATGTCCA
ATGCCCTCTCCACCGCATTCGGCATCGACTTGTCCAGCGAGGTCAAGGACAAGCACCCCGACAGAGACATCAGGA
CCGGCTCTTTTCAAGTCCAAATCAGCTTCAAGGGGTCTGAGCGCTATAGCCTCGTGGTATGCCTCCTCCTCCTTT
TCCTCCTCCATCTTGGGAGGCCGTCATGGCTTGCCCCTCCCTTTCCATTTCTACTCACTCACTGCCAGGTCTCTT
CCACCTTTCTCGCCGCTGCCGCCACCGTCTTCTTCCTCGTCGCTCTCACCGTCATTGCCCGCACGACGCCCCACA
AGAAATGGCCCATTCTCCGCCTCATCATCATTGGCTTGCTTGGTCTCACCATGGGCCTCATTGCCATCATTGCCG
CAGTCTCGGATGCCATGTCCTCCTTTGTCGATTCGGCGTGGGTCATGCCATCCATCACAATCTTCTGGACCATTA
TCCTCATCCTCACGCACATCAATGGCGAAGGCATCCGCCGCAATGCGCACATCTTTGGTGCCCGCCGTCGCGCCC
ATGACACAGACGCTTATGCCCCCATTTCTCTTCCACTTACTCCCATGCACACCTGGTCTCCTCAGGATGACAAGT
CCCTTGTCCATCAAGAAAACACCTCGGACTCTCTGCCTCGGGGCCCTGCCCACGCCTGGCCTAGCCATGGTCAGC
AAGCAAGTGCTTCCCGTGCGCCGTCACCCCTGCCTTACCAGGATCGCCAACAGTGGCCTCTGTAGAGAACAGACA
ACCATGGTTGGCCATCAAGGACAAATCCCGGTTCGTGCTTGTATATTTTCTGGAATAATTGGCCTTGTTCCGTTA
CATTGGGTGCATTTAGCCATTGCAATTTCTAATGTTTCCAAGAAATCACCATGCCAAGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail