Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4803
Gene name
LocationContig_412:6490..8043
Strand+
Gene length (bp)1553
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05291 Bystin Bystin 2.8E-119 154 461

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60071|YBB9_SCHPO Uncharacterized protein C13G1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.09 PE=1 SV=1 1 460 1.0E-94
sp|P51406|BYS_DROME Bystin OS=Drosophila melanogaster GN=bys PE=1 SV=2 113 464 8.0E-92
sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens GN=BYSL PE=1 SV=3 1 469 1.0E-88
sp|A9UNU6|BYST_MONBE Bystin OS=Monosiga brevicollis GN=bysl PE=3 SV=1 114 463 2.0E-86
sp|Q80WL2|BYST_RAT Bystin OS=Rattus norvegicus GN=Bysl PE=1 SV=3 1 461 6.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60071|YBB9_SCHPO Uncharacterized protein C13G1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.09 PE=1 SV=1 1 460 1.0E-94
sp|P51406|BYS_DROME Bystin OS=Drosophila melanogaster GN=bys PE=1 SV=2 113 464 8.0E-92
sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens GN=BYSL PE=1 SV=3 1 469 1.0E-88
sp|A9UNU6|BYST_MONBE Bystin OS=Monosiga brevicollis GN=bysl PE=3 SV=1 114 463 2.0E-86
sp|Q80WL2|BYST_RAT Bystin OS=Rattus norvegicus GN=Bysl PE=1 SV=3 1 461 6.0E-86
sp|Q5E9N0|BYST_BOVIN Bystin OS=Bos taurus GN=BYSL PE=2 SV=1 3 469 2.0E-85
sp|A7S7F2|BYST_NEMVE Bystin OS=Nematostella vectensis GN=bysl PE=3 SV=1 172 459 2.0E-85
sp|O54825|BYST_MOUSE Bystin OS=Mus musculus GN=Bysl PE=1 SV=3 1 477 6.0E-83
sp|Q20932|BYN1_CAEEL Cell adhesion protein byn-1 OS=Caenorhabditis elegans GN=byn-1 PE=3 SV=2 18 453 5.0E-82
sp|Q54IS0|BYST_DICDI Bystin OS=Dictyostelium discoideum GN=bysl PE=3 SV=1 175 460 3.0E-81
sp|P38333|ENP1_YEAST Essential nuclear protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENP1 PE=1 SV=1 1 476 5.0E-81
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2951
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4803 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2210
Ophiocordyceps camponoti-floridani Ophcf2|02813
Ophiocordyceps camponoti-rufipedis Ophun1|3559
Ophiocordyceps kimflemingae Ophio5|8514
Ophiocordyceps subramaniannii Hirsu2|4987

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4803
MPKAAKDTAMRQTRRHNPLQDDIMATGLSRNKPSKKPSKHASHGDGQAFVDSQASSNILRIGRELAAEDRLTSEA
CDAVNPFALDSRFVTDGDNQDPDWDDYETWGGEQDEIEDNEVDPADLEAWRRFNPDDDDLLKYGWDGKPADADAD
AGEAVNLGKLIYDKIMALPQFHMRQEPGAPDSQDDFPPRVVDAYTKVGQILSRYRSGPLPKIFKILPTIPQWEAI
LQLTRPESWTPSACFQATRIFVSHNPLVVQRFLEMVLLEKVRDDVYENKKLNPHLFNALKKALYKPAAFFKGFLL
PLARSGTCTLLEARIVSAALVRVSIPVLYSGAAINCLCEIAAEETCQESNAGGAINILIKALLDKRYALPYQVID
ALVFHFLRFRTSSAPIQDESKGAHDNSQAKLPVIWHQSLLVFAQRYKNDITEDQREALLDLLLTRGHVTIGPEVR
RELLAGRGRGVAMMPQSAEWDGDDTMDIDAESVKMIETRAAEIKRQNLG*
Coding >OphauG2|4803
ATGCCCAAGGCAGCCAAAGACACGGCCATGCGCCAAACACGGCGACATAATCCACTTCAAGACGACATAATGGCG
ACGGGCCTCTCTCGAAACAAGCCCAGCAAGAAACCTTCCAAGCACGCTTCACATGGCGACGGCCAAGCCTTTGTC
GACTCGCAAGCCTCCAGCAACATTCTGCGCATAGGCCGCGAGCTGGCCGCGGAGGACCGGCTCACGTCTGAAGCC
TGTGATGCTGTCAATCCTTTTGCCCTCGACTCGCGCTTTGTCACCGACGGCGACAATCAGGACCCCGACTGGGAC
GATTATGAGACTTGGGGCGGCGAGCAAGACGAAATTGAGGACAACGAGGTGGACCCTGCCGATCTAGAAGCATGG
CGGAGATTCAATCCCGATGACGACGACTTGCTCAAGTATGGCTGGGACGGGAAGCCCGCCGACGCCGACGCCGAC
GCAGGCGAGGCTGTCAACCTTGGCAAGTTGATATACGACAAGATCATGGCCCTTCCCCAATTCCACATGCGGCAA
GAACCCGGAGCGCCAGACTCCCAAGACGACTTTCCCCCAAGGGTCGTCGACGCATATACAAAGGTCGGACAAATC
CTGTCGCGCTATAGATCCGGTCCTCTTCCCAAGATATTCAAGATTTTGCCCACCATCCCGCAATGGGAGGCCATC
CTCCAACTGACAAGACCAGAGAGCTGGACGCCTAGTGCCTGCTTCCAGGCCACGCGCATCTTTGTCTCGCATAAT
CCCCTTGTCGTCCAGCGCTTTCTTGAAATGGTGCTGCTCGAAAAGGTACGCGACGACGTTTACGAAAACAAGAAG
CTAAACCCCCATCTCTTCAATGCCTTGAAAAAGGCATTGTATAAGCCGGCAGCCTTTTTCAAAGGGTTTCTATTG
CCATTGGCGCGCAGTGGAACTTGCACGCTGCTCGAGGCGCGCATCGTTTCGGCTGCCCTTGTCAGGGTATCCATT
CCCGTCTTGTACTCAGGAGCCGCCATCAACTGCCTGTGCGAAATTGCTGCCGAGGAAACATGCCAAGAAAGCAAT
GCCGGGGGCGCAATCAACATCTTGATCAAGGCACTTCTGGACAAGAGATATGCTTTGCCCTATCAAGTCATTGAT
GCTCTCGTCTTCCACTTTTTGCGCTTTCGCACTAGTAGCGCGCCAATCCAAGACGAGAGCAAAGGGGCGCACGAC
AACAGCCAGGCCAAGTTGCCCGTTATCTGGCACCAGAGCTTGCTGGTTTTCGCGCAGCGGTACAAGAACGACATT
ACTGAAGACCAGCGCGAGGCGTTGCTTGACCTCTTGTTGACCCGGGGTCATGTGACCATTGGGCCCGAGGTGCGC
CGGGAGCTGTTGGCTGGTCGCGGGCGTGGAGTTGCCATGATGCCTCAGTCCGCCGAGTGGGATGGGGACGATACC
ATGGATATTGATGCAGAAAGTGTCAAGATGATTGAAACACGGGCAGCGGAGATTAAGAGGCAAAATCTTGGCTGA
Transcript >OphauG2|4803
ATGCCCAAGGCAGCCAAAGACACGGCCATGCGCCAAACACGGCGACATAATCCACTTCAAGACGACATAATGGCG
ACGGGCCTCTCTCGAAACAAGCCCAGCAAGAAACCTTCCAAGCACGCTTCACATGGCGACGGCCAAGCCTTTGTC
GACTCGCAAGCCTCCAGCAACATTCTGCGCATAGGCCGCGAGCTGGCCGCGGAGGACCGGCTCACGTCTGAAGCC
TGTGATGCTGTCAATCCTTTTGCCCTCGACTCGCGCTTTGTCACCGACGGCGACAATCAGGACCCCGACTGGGAC
GATTATGAGACTTGGGGCGGCGAGCAAGACGAAATTGAGGACAACGAGGTGGACCCTGCCGATCTAGAAGCATGG
CGGAGATTCAATCCCGATGACGACGACTTGCTCAAGTATGGCTGGGACGGGAAGCCCGCCGACGCCGACGCCGAC
GCAGGCGAGGCTGTCAACCTTGGCAAGTTGATATACGACAAGATCATGGCCCTTCCCCAATTCCACATGCGGCAA
GAACCCGGAGCGCCAGACTCCCAAGACGACTTTCCCCCAAGGGTCGTCGACGCATATACAAAGGTCGGACAAATC
CTGTCGCGCTATAGATCCGGTCCTCTTCCCAAGATATTCAAGATTTTGCCCACCATCCCGCAATGGGAGGCCATC
CTCCAACTGACAAGACCAGAGAGCTGGACGCCTAGTGCCTGCTTCCAGGCCACGCGCATCTTTGTCTCGCATAAT
CCCCTTGTCGTCCAGCGCTTTCTTGAAATGGTGCTGCTCGAAAAGGTACGCGACGACGTTTACGAAAACAAGAAG
CTAAACCCCCATCTCTTCAATGCCTTGAAAAAGGCATTGTATAAGCCGGCAGCCTTTTTCAAAGGGTTTCTATTG
CCATTGGCGCGCAGTGGAACTTGCACGCTGCTCGAGGCGCGCATCGTTTCGGCTGCCCTTGTCAGGGTATCCATT
CCCGTCTTGTACTCAGGAGCCGCCATCAACTGCCTGTGCGAAATTGCTGCCGAGGAAACATGCCAAGAAAGCAAT
GCCGGGGGCGCAATCAACATCTTGATCAAGGCACTTCTGGACAAGAGATATGCTTTGCCCTATCAAGTCATTGAT
GCTCTCGTCTTCCACTTTTTGCGCTTTCGCACTAGTAGCGCGCCAATCCAAGACGAGAGCAAAGGGGCGCACGAC
AACAGCCAGGCCAAGTTGCCCGTTATCTGGCACCAGAGCTTGCTGGTTTTCGCGCAGCGGTACAAGAACGACATT
ACTGAAGACCAGCGCGAGGCGTTGCTTGACCTCTTGTTGACCCGGGGTCATGTGACCATTGGGCCCGAGGTGCGC
CGGGAGCTGTTGGCTGGTCGCGGGCGTGGAGTTGCCATGATGCCTCAGTCCGCCGAGTGGGATGGGGACGATACC
ATGGATATTGATGCAGAAAGTGTCAAGATGATTGAAACACGGGCAGCGGAGATTAAGAGGCAAAATCTTGGCTGA
Gene >OphauG2|4803
ATGCCCAAGGCAGCCAAAGACACGGCCATGCGCCAAACACGGCGACATAATCCACTTCAAGACGACATAATGGCG
ACGGGCCTCTCTCGAAACAAGCCCAGCAAGAAACCTTCCAAGCACGCTTCACATGGCGACGGCCAAGCCTTTGTC
GACTCGCAAGCCTCCAGCAACATTCTGCGCATAGGCCGCGAGCTGGCCGCGGAGGACCGGCTCACGTCTGAAGCC
TGTGATGCTGTCAATCCTTTTGCCCTCGACTCGCGCTTTGTCACCGACGGCGACAATCAGGACCCCGACTGGGAC
GATTATGAGACTTGGGGCGGCGAGCAAGACGAAATTGAGGACAACGAGGTGGACCCTGCCGATCTAGAAGCATGG
CGGAGATTCAATCCCGATGACGACGACTTGCTCAAGTATGGCTGGGACGGGAAGCCCGCCGACGCCGACGCCGAC
GCAGGCGAGGCTGTCAACCTTGGCAAGTTGATATACGACAAGATCATGGCCCTTCCCCAATTCCACATGCGGCAA
GAACCCGGAGCGCCAGACTCCCAAGACGACTTTCCCCCAAGGGTCGTCGACGCATATACAAAGCAGGTGCTCCGC
CTCCACGGCTCGCCGCCATGACGGCTGACAGTGAATACAGGGTCGGACAAATCCTGTCGCGCTATAGATCCGGTC
CTCTTCCCAAGATATTCAAGATTTTGCCCACCATCCCGCAATGGGAGGCCATCCTCCAACTGACAAGACCAGAGA
GCTGGACGCCTAGTGCCTGCTTCCAGGCCACGCGCATCTTTGTCTCGCATAATCCCCTTGTCGTCCAGCGCTTTC
TTGAAATGGTGCTGCTCGAAAAGGTACGCGACGACGTTTACGAAAACAAGAAGCTAAACCCCCATCTCTTCAATG
CCTTGAAAAAGGCATTGTATAAGCCGGCAGCCTTTTTCAAAGGGTTTCTATTGCCATTGGCGCGCAGTGGAACTT
GCACGCTGCTCGAGGCGCGCATCGTTTCGGCTGCCCTTGTCAGGGTATCCATTCCCGTCTTGTACTCAGGAGCCG
CCATCAACTGCCTGTGCGAAATTGCTGCCGAGGAAACATGCCAAGAAAGCAATGCCGGGGGCGCAATCAACATCT
TGATCAAGGCACTTCTGGACAAGAGATATGCTTTGCCCTATCAAGTCATTGATGCTCTCGTCTTCCACTTTTTGC
GCTTTCGCACTAGTAGCGCGCCAATCCAAGACGAGAGCAAAGGGGCGCACGACAACAGCCAGGCCAAGTTGCCCG
TTATCTGGCACCAGAGCTTGCTGGTTTTCGCGCAGCGGTACAAGAACGACATTACTGAAGACCAGCGCGAGGCGT
TGCTTGACCTCTTGTTGACCCGGGGTCATGTGACCATTGGGCCCGAGGTGCGCCGGGAGCTGTTGGCTGGTCGCG
GGCGTGGAGTTGCCATGATGCCTCAGTCCGCCGAGTGGGATGGGGACGATACCATGGATATTGATGCAGAAAGTG
TCAAGATGATTGAAACACGGGCAGCGGAGATTAAGAGGCAAAATCTTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail