Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4799
Gene name
LocationContig_411:9495..12140
Strand+
Gene length (bp)2645
Transcript length (bp)2313
Coding sequence length (bp)2313
Protein length (aa) 771

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00888 Cullin Cullin family 6.9E-190 24 671
PF10557 Cullin_Nedd8 Cullin protein neddylation domain 5.9E-25 702 764

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1 2 770 0.0E+00
sp|O60999|CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum GN=culA PE=1 SV=1 9 770 0.0E+00
sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster GN=Cul1 PE=1 SV=2 4 770 0.0E+00
sp|O13790|CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul1 PE=1 SV=1 1 770 0.0E+00
sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2 2 770 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1 2 770 0.0E+00
sp|O60999|CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum GN=culA PE=1 SV=1 9 770 0.0E+00
sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster GN=Cul1 PE=1 SV=2 4 770 0.0E+00
sp|O13790|CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul1 PE=1 SV=1 1 770 0.0E+00
sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2 2 770 0.0E+00
sp|Q9WTX6|CUL1_MOUSE Cullin-1 OS=Mus musculus GN=Cul1 PE=1 SV=1 5 770 0.0E+00
sp|Q17389|CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans GN=cul-1 PE=1 SV=1 19 770 9.0E-175
sp|Q9XZJ3|CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum GN=culB PE=2 SV=1 19 769 2.0E-148
sp|Q12018|CDC53_YEAST Cell division control protein 53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC53 PE=1 SV=1 14 770 5.0E-146
sp|Q9D4H8|CUL2_MOUSE Cullin-2 OS=Mus musculus GN=Cul2 PE=1 SV=2 15 770 3.0E-144
sp|Q5RCF3|CUL2_PONAB Cullin-2 OS=Pongo abelii GN=CUL2 PE=2 SV=1 15 770 2.0E-140
sp|Q13617|CUL2_HUMAN Cullin-2 OS=Homo sapiens GN=CUL2 PE=1 SV=2 15 770 2.0E-140
sp|Q21346|CUL6_CAEEL Cullin-6 OS=Caenorhabditis elegans GN=cul-6 PE=1 SV=1 20 764 1.0E-133
sp|Q54XF7|CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum GN=culE PE=3 SV=1 24 764 2.0E-118
sp|Q17390|CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans GN=cul-2 PE=1 SV=3 81 770 1.0E-116
sp|B5DF89|CUL3_RAT Cullin-3 OS=Rattus norvegicus GN=Cul3 PE=1 SV=2 12 768 6.0E-116
sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1 12 768 8.0E-116
sp|Q6DE95|CUL3A_XENLA Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1 12 768 1.0E-115
sp|Q6GPF3|CUL3B_XENLA Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1 12 768 4.0E-115
sp|A4IHP4|CUL3_XENTR Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1 12 768 6.0E-115
sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2 12 768 9.0E-115
sp|Q9ZVH4|CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana GN=CUL3A PE=1 SV=1 53 760 5.0E-114
sp|Q9C9L0|CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana GN=CUL3B PE=1 SV=1 23 768 1.0E-110
sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=culC PE=3 SV=1 82 768 4.0E-110
sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE=1 SV=1 19 760 4.0E-108
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 50 768 2.0E-96
sp|Q8LGH4|CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana GN=CUL4 PE=1 SV=1 23 760 3.0E-95
sp|Q9SRZ0|CUL2_ARATH Cullin-2 OS=Arabidopsis thaliana GN=CUL2 PE=1 SV=1 20 770 3.0E-94
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=1 SV=1 50 763 9.0E-93
sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=4 23 760 1.0E-91
sp|A2A432|CUL4B_MOUSE Cullin-4B OS=Mus musculus GN=Cul4b PE=1 SV=1 23 760 2.0E-91
sp|Q17391|CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans GN=cul-3 PE=1 SV=2 20 768 7.0E-89
sp|Q9JJ31|CUL5_RAT Cullin-5 OS=Rattus norvegicus GN=Cul5 PE=1 SV=3 24 764 2.0E-83
sp|Q9D5V5|CUL5_MOUSE Cullin-5 OS=Mus musculus GN=Cul5 PE=1 SV=3 24 764 5.0E-83
sp|Q93034|CUL5_HUMAN Cullin-5 OS=Homo sapiens GN=CUL5 PE=1 SV=4 24 764 9.0E-83
sp|Q5RB36|CUL5_PONAB Cullin-5 OS=Pongo abelii GN=CUL5 PE=2 SV=3 24 764 2.0E-82
sp|Q23639|CUL5_CAEEL Cullin-5 OS=Caenorhabditis elegans GN=cul-5 PE=1 SV=2 107 764 1.0E-80
sp|Q29425|CUL5_RABIT Cullin-5 OS=Oryctolagus cuniculus GN=CUL5 PE=2 SV=3 24 764 2.0E-80
sp|P0CH31|CLL1_ARATH Putative cullin-like protein 1 OS=Arabidopsis thaliana GN=At1g43140 PE=3 SV=1 24 760 9.0E-78
sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul3 PE=1 SV=2 69 764 5.0E-73
sp|O14122|CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul4 PE=1 SV=1 25 770 3.0E-64
sp|Q54CS2|CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum GN=culD PE=3 SV=1 10 617 1.0E-55
sp|Q17392|CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans GN=cul-4 PE=1 SV=3 227 768 4.0E-54
sp|P53202|CUL3_YEAST Cullin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUL3 PE=1 SV=1 451 768 4.0E-25
sp|Q9XIE9|CLL2_ARATH Putative cullin-like protein 2 OS=Arabidopsis thaliana GN=At1g59790 PE=3 SV=2 15 388 1.0E-24
sp|Q9XIE8|CLL3_ARATH Cullin-like protein 3 OS=Arabidopsis thaliana GN=At1g59800 PE=3 SV=2 15 275 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0043170 macromolecule metabolic process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0019538 protein metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0019899 enzyme binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0044260 cellular macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1054
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4799 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3567
Ophiocordyceps camponoti-floridani Ophcf2|03939
Ophiocordyceps camponoti-rufipedis Ophun1|1151
Ophiocordyceps camponoti-rufipedis Ophun1|557
Ophiocordyceps kimflemingae Ophio5|6378
Ophiocordyceps subramaniannii Hirsu2|9975

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4799
MATRTASPSQMPPVPNREDISATWNYLQTGINRIMLHLDRGIDMQMYMGVYTAVHNFCTSQKAVGLGGPAMHSNH
RGAHLLGEELYNKLIQYLRTHLNQVVEDSKSHTEEALLTFYIKEWNRYTIAAKYIHHLFRYLNRHWVKREIDEGK
KNIFDVYTLHLVQWRQVLFEKVSGKVMGSVLKLVEKQRSGETIEHGQIKQVVDSFVSLGLDEVDPSKSTLEVYRF
HFERPFLAATKDFYEAESKQFVAENSVVEYMKKAEARLDEEQERVSMYLHQDIAVPLKKTCNMALIADHSALLRD
EFQLLLDTDREEDMARMYNLLARIPDGLEPLRVRFETHVRKAGHNAVQKVQSSEGDKLEPKVYVDALLEVHGRYQ
SLVKKAFNDEAEFTRSLDNACREFVNRNAVCKSASSKSPELLAKYTDILLRKSGTGIEEADLERTLSQIMVVFRY
IEDKDVFQKYYSRMLARRLVHSNSSSDDAETSMISKLKEACGFEYTNKLQRMFQDMQISKDLNKEFGDHLASIGS
TSGIDSTYSILGTGFWPLTPPTTQFHPPSDITTEIDRFVRFYKHKHDGRKLTWLWHLCKGEIRTNYCRNSKTPFT
LQVSIYQMAILLLFNEVDSYMYEDMLEATQLTGEVLDQALSVILKAKVLLMSGGAGERPGPGKKFSLNYDFKSKK
IRVNLNLGGIKETKQEEAETNKTIEEDRKLVLQSAIVRIMKARQRMKHTQLVSETINQIRSRFVPKVADIKKCIE
ILLDKEYLERLEDDELGYLA*
Coding >OphauG2|4799
ATGGCCACTCGTACGGCGAGCCCGAGCCAGATGCCTCCAGTGCCAAATCGCGAGGACATTAGTGCAACATGGAAC
TATCTCCAGACGGGCATCAACCGCATCATGCTGCATCTCGACCGAGGCATCGACATGCAAATGTACATGGGAGTA
TACACAGCCGTTCACAATTTTTGCACCTCGCAAAAGGCTGTTGGCCTTGGTGGTCCGGCTATGCACTCTAACCAT
CGCGGAGCCCACCTCCTCGGCGAAGAGCTCTATAACAAGCTGATTCAATACCTACGAACACACCTCAACCAAGTG
GTGGAAGATTCCAAGTCGCACACGGAAGAAGCTTTGCTTACCTTTTACATTAAGGAGTGGAATAGGTATACTATT
GCGGCAAAGTATATACACCATCTTTTCCGCTATCTCAATCGCCATTGGGTCAAGCGAGAAATCGACGAGGGCAAA
AAGAACATCTTCGACGTTTACACGCTGCACCTGGTTCAATGGCGTCAGGTGCTTTTTGAAAAGGTATCAGGAAAA
GTTATGGGCTCTGTCTTGAAGCTTGTGGAGAAGCAGCGTAGTGGCGAGACGATTGAACACGGCCAAATCAAGCAA
GTTGTTGACTCGTTTGTTTCGCTGGGGCTCGACGAAGTGGACCCGTCAAAGTCGACACTCGAAGTCTACCGCTTC
CACTTTGAGCGGCCCTTTTTGGCTGCCACCAAGGATTTCTACGAAGCCGAGTCGAAGCAGTTTGTGGCGGAGAAC
AGCGTTGTCGAGTACATGAAGAAGGCCGAGGCGCGGCTAGATGAGGAACAGGAGCGCGTCAGCATGTATCTGCAT
CAGGATATTGCTGTGCCGTTGAAGAAGACGTGCAACATGGCGCTCATTGCCGACCACTCGGCACTGCTGCGCGAC
GAGTTTCAGCTGCTGCTCGACACGGATCGCGAAGAGGACATGGCGAGAATGTATAATCTCTTGGCGCGCATTCCT
GATGGGCTTGAGCCTCTGCGAGTTCGGTTCGAGACGCATGTGCGCAAGGCTGGTCATAATGCGGTGCAAAAAGTG
CAATCATCTGAAGGGGATAAGCTGGAGCCCAAGGTCTACGTGGATGCGTTACTCGAGGTTCACGGTCGCTATCAG
TCCCTGGTCAAGAAGGCTTTCAACGACGAGGCCGAGTTTACGCGCTCGCTCGACAATGCGTGCAGGGAATTCGTC
AATCGCAATGCCGTGTGTAAATCGGCTTCGAGCAAGTCGCCCGAGCTGCTGGCCAAGTACACTGACATTCTGTTG
CGCAAGAGCGGCACCGGCATCGAAGAGGCCGACTTGGAGCGAACCCTCAGCCAAATCATGGTTGTCTTTAGATAT
ATTGAGGACAAGGACGTCTTTCAAAAGTATTACTCGCGCATGTTGGCCCGGCGGCTGGTGCACAGCAACTCGTCG
TCGGACGATGCCGAGACTAGCATGATTAGCAAGCTCAAGGAGGCTTGTGGCTTCGAGTACACAAATAAGCTGCAG
CGCATGTTCCAGGACATGCAAATCTCCAAGGACCTCAACAAGGAATTTGGAGACCATCTGGCCAGCATTGGGTCG
ACGAGCGGCATCGACTCGACCTACTCGATTCTCGGCACCGGCTTTTGGCCCCTGACGCCACCCACCACCCAATTC
CACCCCCCTAGCGACATTACCACCGAGATTGACCGCTTTGTGCGCTTTTACAAGCACAAGCACGATGGACGCAAG
CTCACGTGGTTGTGGCATCTCTGCAAAGGCGAAATTAGGACAAACTATTGCCGGAACAGCAAGACGCCCTTTACC
CTGCAAGTATCCATCTACCAAATGGCCATTTTACTTCTCTTCAACGAGGTCGATAGCTACATGTATGAGGACATG
CTCGAGGCGACGCAGCTTACTGGCGAGGTTCTCGACCAGGCACTGTCTGTAATTCTCAAGGCCAAGGTGCTGCTC
ATGTCTGGCGGTGCCGGCGAGCGGCCCGGACCAGGCAAGAAGTTTAGTCTAAATTATGACTTTAAAAGCAAGAAG
ATTCGGGTAAACCTGAATCTAGGCGGCATCAAGGAGACGAAGCAGGAAGAGGCTGAAACGAATAAAACGATTGAG
GAGGATCGAAAGCTGGTGCTTCAGTCTGCCATTGTGCGCATCATGAAGGCACGCCAACGAATGAAGCACACGCAA
CTAGTCAGCGAAACCATTAACCAAATACGCTCACGCTTTGTGCCCAAGGTGGCGGATATTAAAAAGTGCATCGAG
ATTTTGCTCGACAAGGAGTATCTGGAGCGGCTGGAGGATGACGAATTGGGATACCTGGCCTAA
Transcript >OphauG2|4799
ATGGCCACTCGTACGGCGAGCCCGAGCCAGATGCCTCCAGTGCCAAATCGCGAGGACATTAGTGCAACATGGAAC
TATCTCCAGACGGGCATCAACCGCATCATGCTGCATCTCGACCGAGGCATCGACATGCAAATGTACATGGGAGTA
TACACAGCCGTTCACAATTTTTGCACCTCGCAAAAGGCTGTTGGCCTTGGTGGTCCGGCTATGCACTCTAACCAT
CGCGGAGCCCACCTCCTCGGCGAAGAGCTCTATAACAAGCTGATTCAATACCTACGAACACACCTCAACCAAGTG
GTGGAAGATTCCAAGTCGCACACGGAAGAAGCTTTGCTTACCTTTTACATTAAGGAGTGGAATAGGTATACTATT
GCGGCAAAGTATATACACCATCTTTTCCGCTATCTCAATCGCCATTGGGTCAAGCGAGAAATCGACGAGGGCAAA
AAGAACATCTTCGACGTTTACACGCTGCACCTGGTTCAATGGCGTCAGGTGCTTTTTGAAAAGGTATCAGGAAAA
GTTATGGGCTCTGTCTTGAAGCTTGTGGAGAAGCAGCGTAGTGGCGAGACGATTGAACACGGCCAAATCAAGCAA
GTTGTTGACTCGTTTGTTTCGCTGGGGCTCGACGAAGTGGACCCGTCAAAGTCGACACTCGAAGTCTACCGCTTC
CACTTTGAGCGGCCCTTTTTGGCTGCCACCAAGGATTTCTACGAAGCCGAGTCGAAGCAGTTTGTGGCGGAGAAC
AGCGTTGTCGAGTACATGAAGAAGGCCGAGGCGCGGCTAGATGAGGAACAGGAGCGCGTCAGCATGTATCTGCAT
CAGGATATTGCTGTGCCGTTGAAGAAGACGTGCAACATGGCGCTCATTGCCGACCACTCGGCACTGCTGCGCGAC
GAGTTTCAGCTGCTGCTCGACACGGATCGCGAAGAGGACATGGCGAGAATGTATAATCTCTTGGCGCGCATTCCT
GATGGGCTTGAGCCTCTGCGAGTTCGGTTCGAGACGCATGTGCGCAAGGCTGGTCATAATGCGGTGCAAAAAGTG
CAATCATCTGAAGGGGATAAGCTGGAGCCCAAGGTCTACGTGGATGCGTTACTCGAGGTTCACGGTCGCTATCAG
TCCCTGGTCAAGAAGGCTTTCAACGACGAGGCCGAGTTTACGCGCTCGCTCGACAATGCGTGCAGGGAATTCGTC
AATCGCAATGCCGTGTGTAAATCGGCTTCGAGCAAGTCGCCCGAGCTGCTGGCCAAGTACACTGACATTCTGTTG
CGCAAGAGCGGCACCGGCATCGAAGAGGCCGACTTGGAGCGAACCCTCAGCCAAATCATGGTTGTCTTTAGATAT
ATTGAGGACAAGGACGTCTTTCAAAAGTATTACTCGCGCATGTTGGCCCGGCGGCTGGTGCACAGCAACTCGTCG
TCGGACGATGCCGAGACTAGCATGATTAGCAAGCTCAAGGAGGCTTGTGGCTTCGAGTACACAAATAAGCTGCAG
CGCATGTTCCAGGACATGCAAATCTCCAAGGACCTCAACAAGGAATTTGGAGACCATCTGGCCAGCATTGGGTCG
ACGAGCGGCATCGACTCGACCTACTCGATTCTCGGCACCGGCTTTTGGCCCCTGACGCCACCCACCACCCAATTC
CACCCCCCTAGCGACATTACCACCGAGATTGACCGCTTTGTGCGCTTTTACAAGCACAAGCACGATGGACGCAAG
CTCACGTGGTTGTGGCATCTCTGCAAAGGCGAAATTAGGACAAACTATTGCCGGAACAGCAAGACGCCCTTTACC
CTGCAAGTATCCATCTACCAAATGGCCATTTTACTTCTCTTCAACGAGGTCGATAGCTACATGTATGAGGACATG
CTCGAGGCGACGCAGCTTACTGGCGAGGTTCTCGACCAGGCACTGTCTGTAATTCTCAAGGCCAAGGTGCTGCTC
ATGTCTGGCGGTGCCGGCGAGCGGCCCGGACCAGGCAAGAAGTTTAGTCTAAATTATGACTTTAAAAGCAAGAAG
ATTCGGGTAAACCTGAATCTAGGCGGCATCAAGGAGACGAAGCAGGAAGAGGCTGAAACGAATAAAACGATTGAG
GAGGATCGAAAGCTGGTGCTTCAGTCTGCCATTGTGCGCATCATGAAGGCACGCCAACGAATGAAGCACACGCAA
CTAGTCAGCGAAACCATTAACCAAATACGCTCACGCTTTGTGCCCAAGGTGGCGGATATTAAAAAGTGCATCGAG
ATTTTGCTCGACAAGGAGTATCTGGAGCGGCTGGAGGATGACGAATTGGGATACCTGGCCTAA
Gene >OphauG2|4799
ATGGCCACTCGTACGGCGAGCCCGAGCCAGATGCCTCCAGTGCCAAATCGCGAGGACATTAGTGCAACGTGAGTC
TTGGGCCGCCCCGTGTCGATGGCGTTGCTGAACAGAGCAGATGGAACTATCTCCAGACGGGCATCAACCGCATCA
TGCTGCATCTCGACCGAGGCATCGACATGCAAATGTACATGGGAGTATACACGTGCGCCGGATTTCGTTCCTTGG
CCTCGATGCTGTTTCACGGCTGACGGAAAATGCAGAGCCGTTCACAATTTTTGCACCTCGCAAAAGGCTGTTGGC
CTTGGTGGTCCGGCTATGCACTCTAACCATCGCGGAGGTAGGCTTGCCAGGCTTGTGCTCCGCATTGAAGCAAAT
TGCTGACTCTGTACACGGCAGCCCACCTCCTCGGCGAAGAGCTCTATAACAAGCTGATTCAATACCTACGAACAC
ACCTCAACCAAGTGGTGGAAGATTCCAAGTCGCACACGGAAGAAGCTTTGCTTACCTTTTACATTAAGGAGTGGA
ATAGGTATACTATTGCGGCAAAGTATATACACCATCTTTTCCGCTATCTCAATCGCCATTGGGTCAAGCGAGAAA
TCGACGAGGGCAAAAAGAACATCTTCGACGTTTACACGCTGCACCTGGTTCAATGGCGTCAGGTGCTTTTTGAAA
AGGTATCAGGAAAAGTTATGGGCTCTGTCTTGAAGCTTGTGGAGAAGCAGCGTAGTGGCGAGACGATTGAACACG
GCCAAATCAAGCAAGTTGTTGACTCGTTTGTTTCGCTGGGGCTCGACGAAGTGGACCCGTCAAAGTCGACACTCG
AAGTCTACCGCTTCCACTTTGAGCGGCCCTTTTTGGCTGCCACCAAGGATTTCTACGAAGCCGAGTCGAAGCAGT
TTGTGGCGGAGAACAGCGTTGTCGAGTACATGAAGAAGGCCGAGGCGCGGCTAGATGAGGAACAGGAGCGCGTCA
GCATGTATCTGCATCAGGATATTGCTGTGCCGTTGAAGAAGACGTGCAACATGGCGCTCATTGCCGACCACTCGG
CACTGCTGCGCGACGAGTTTCAGCTGCTGCTCGACACGGATCGCGAAGAGGACATGGCGAGAATGTATAATCTCT
TGGCGCGCATTCCTGATGGGCTTGAGCCTCTGCGAGTTCGGTTCGAGACGCATGTGCGCAAGGCTGGTCATAATG
CGGTGCAAAAAGTGCAATCATCTGAAGGGGATAAGCTGGAGCCCAAGGTCTACGTGGATGCGTTACTCGAGGTTC
ACGGTCGCTATCAGTCCCTGGTCAAGAAGGCTTTCAACGACGAGGCCGAGTTTACGCGCTCGCTCGACAATGCGT
GCAGGGAATTCGTCAATCGCAATGCCGTGTGTAAATCGGCTTCGAGCAAGTCGCCCGAGCTGCTGGCCAAGTACA
CTGACATTCTGTTGCGCAAGAGCGGCACCGGCATCGAAGAGGCCGACTTGGAGCGAACCCTCAGCCAAATCATGG
TTGTCTTTAGATATATTGAGGACAAGGACGTCTTTCAAAAGTATTACTCGCGCATGTTGGCCCGGCGGCTGGTGC
ACAGCAACTCGTCGTCGGACGATGCCGAGACTAGCATGATTAGCAAGCTCAAGGAGGCTTGTGGCTTCGAGTACA
CAAATAAGCTGCAGCGCATGTTCCAGGACATGCAAATCTCCAAGGACCTCAACAAGGAATTTGGAGACCATCTGG
CCAGCATTGGGTCGACGAGCGGCATCGACTCGACCTACTCGATTCTCGGCACCGGCTTTTGGCCCCTGACGCCAC
CCACCACCCAATTCCACCCCCCTAGCGACATTACCACCGAGATTGACCGCTTTGTGCGCTTTTACAAGCACAAGC
ACGATGGACGCAAGCTCACGTGGTTGTGGCATCTCTGCAAAGGCGAAATTAGGACAAACTATTGCCGGAACAGCA
AGACGCCCTTTACCCTGCAAGTATCCATCTACCAAATGGCCATTTTACTTCTCTTCAACGAGGTCGATAGCTACA
TGTATGAGGACATGCTCGAGGCGACGCAGCTTACTGGCGAGGTTCTCGACCAGGCACTGTCTGTAATTCTCAAGG
CCAAGGTGCTGCTCATGTCTGGCGGTGCCGGCGAGCGGCCCGGACCAGGCAAGAAGTTTAGTCTAAATTATGACT
TTAAAAGCAAGAAGATTCGGGTAAACCTGAATCTAGGCGGCATCAAGGAGACGAAGCAGGAAGAGGCTGAAACGA
ATAAAACGATTGAGGAGGATCGAAAGCTGGTGCTTCAGGTACGGTTGAATCTTTCTCTCTTTTTTTGGCCCCCTA
TTTTTCCCCTCCTTTCTTTGACTTTTTTGCCCCCTTTTTTCCCTATTTTGGCCTTTTTGCTACGTCTTGTTTACA
TATAGTCTCTTCTTTTTCTTTTATTTGTTTGAAAGTATATTGCTAACGGCTACCAGTCTGCCATTGTGCGCATCA
TGAAGGCACGCCAACGAATGAAGCACACGCAACTAGTCAGCGAAACCATTAACCAAATACGCTCACGCTTTGTGC
CCAAGGTGGCGGATATTAAAAAGTGCATCGAGATTTTGCTCGACAAGGAGTATCTGGAGCGGCTGGAGGATGACG
AATTGGGATACCTGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail