Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4787
Gene name
LocationContig_41:38949..39819
Strand-
Gene length (bp)870
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01205 UPF0029 Uncharacterized protein family UPF0029 8.1E-31 171 275
PF05773 RWD RWD domain 5.0E-05 3 106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25637|YIH1_YEAST Protein IMPACT homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIH1 PE=1 SV=1 3 281 7.0E-46
sp|O13997|YIH1_SCHPO Protein IMPACT homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yih1 PE=3 SV=1 2 287 1.0E-37
sp|A9UMG5|IMPTB_XENTR Protein IMPACT-B OS=Xenopus tropicalis GN=impact-B PE=2 SV=1 7 280 2.0E-35
sp|Q642J4|IMPCT_DANRE Protein IMPACT OS=Danio rerio GN=impact PE=2 SV=1 7 280 2.0E-35
sp|Q5M8G6|IMPTA_XENTR Protein IMPACT-A OS=Xenopus tropicalis GN=impact-A PE=2 SV=1 7 277 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25637|YIH1_YEAST Protein IMPACT homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIH1 PE=1 SV=1 3 281 7.0E-46
sp|O13997|YIH1_SCHPO Protein IMPACT homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yih1 PE=3 SV=1 2 287 1.0E-37
sp|A9UMG5|IMPTB_XENTR Protein IMPACT-B OS=Xenopus tropicalis GN=impact-B PE=2 SV=1 7 280 2.0E-35
sp|Q642J4|IMPCT_DANRE Protein IMPACT OS=Danio rerio GN=impact PE=2 SV=1 7 280 2.0E-35
sp|Q5M8G6|IMPTA_XENTR Protein IMPACT-A OS=Xenopus tropicalis GN=impact-A PE=2 SV=1 7 277 2.0E-33
sp|A7YY45|IMPCT_BOVIN Protein IMPACT OS=Bos taurus GN=IMPACT PE=2 SV=2 6 280 5.0E-30
sp|Q9W625|IMPCT_XENLA Protein IMPACT OS=Xenopus laevis GN=impact PE=2 SV=1 7 277 1.0E-29
sp|O55091|IMPCT_MOUSE Protein IMPACT OS=Mus musculus GN=Impact PE=1 SV=2 2 281 2.0E-29
sp|Q9P2X3|IMPCT_HUMAN Protein IMPACT OS=Homo sapiens GN=IMPACT PE=1 SV=2 6 280 3.0E-28
sp|Q5GFD9|IMPCT_RAT Protein IMPACT OS=Rattus norvegicus GN=Impact PE=1 SV=1 6 281 6.0E-28
sp|Q5GFD8|IMPCT_RABIT Protein IMPACT OS=Oryctolagus cuniculus GN=IMPACT PE=2 SV=1 6 280 2.0E-22
sp|Q9XWF4|IMPCT_CAEEL Protein IMPACT homolog OS=Caenorhabditis elegans GN=Y52B11A.2 PE=3 SV=1 165 273 3.0E-17
sp|Q54JW9|IMPCT_DICDI Protein IMPACT homolog OS=Dictyostelium discoideum GN=impact PE=3 SV=1 152 274 7.0E-15
sp|Q12257|YD177_YEAST IMPACT family member YDL177C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL177C PE=1 SV=1 160 282 1.0E-12
sp|O60090|YO29_SCHPO IMPACT family member C14C8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.09c PE=1 SV=3 163 287 4.0E-09
sp|P32437|YVYE_BACSU IMPACT family member YvyE OS=Bacillus subtilis (strain 168) GN=yvyE PE=3 SV=2 167 261 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6448
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4787 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7748
Ophiocordyceps camponoti-floridani Ophcf2|05833
Ophiocordyceps kimflemingae Ophio5|3595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4787
MSEELKDEVEVLNSIYGPETLSRVDDDGLDTGRPTTWILRLPGEASSLRLGFPAAYPAEAPTVLGTHHSSGGVRG
AGARDLGLLQEAIERVFRAGEVCLYDAVEDVCERLRGMEGRAQAPEEREAAGAATEARDATKLEGSQSKDGDAAG
DEQDDDSAPVWTISEPIVENKSTFVARVATVSSAGQAARCISRLVGSERRLRDATHNMSAWRVREAGVVCQDCDD
DGETAAGARLLHLMHLMGVWDAVVVVSRWYGGVKLGPRRFALINTAARDAFVRAGLVEDKKRAR*
Coding >OphauG2|4787
ATGTCTGAGGAGCTCAAGGACGAGGTCGAGGTTCTGAATTCCATCTATGGACCAGAAACTCTGTCGCGCGTGGAT
GACGATGGCCTCGATACTGGTAGGCCGACGACGTGGATTCTGCGCCTCCCGGGCGAGGCGTCGTCTCTGCGACTA
GGTTTCCCAGCGGCGTACCCAGCCGAGGCGCCAACCGTGCTAGGCACACATCATAGCTCAGGCGGGGTCCGAGGC
GCAGGGGCGCGAGACCTGGGTCTGCTTCAAGAGGCAATCGAGAGGGTTTTCCGAGCAGGAGAGGTTTGTCTGTAT
GATGCGGTGGAGGACGTGTGTGAGAGGCTTCGGGGGATGGAGGGACGAGCGCAAGCACCGGAAGAGCGGGAAGCT
GCCGGTGCTGCAACCGAGGCGAGAGACGCCACGAAGCTCGAGGGCTCGCAAAGCAAGGACGGAGACGCGGCAGGC
GACGAGCAAGACGACGACTCAGCGCCGGTGTGGACTATATCGGAGCCCATTGTTGAAAACAAATCGACCTTTGTG
GCGCGCGTAGCGACAGTGTCGAGCGCGGGGCAGGCAGCGCGATGCATCAGCCGCCTGGTGGGCTCGGAGCGGCGG
CTGCGTGACGCAACGCACAACATGTCGGCGTGGCGGGTGCGCGAGGCCGGCGTCGTCTGCCAGGACTGCGACGAC
GACGGAGAGACGGCAGCGGGGGCTCGTCTCTTGCACCTCATGCACCTCATGGGGGTGTGGGATGCCGTCGTGGTG
GTGTCGCGCTGGTACGGCGGCGTCAAGCTGGGGCCGCGTCGCTTCGCCCTCATCAACACGGCGGCGAGGGATGCG
TTTGTGCGGGCAGGCCTCGTCGAGGACAAGAAGCGGGCCAGGTGA
Transcript >OphauG2|4787
ATGTCTGAGGAGCTCAAGGACGAGGTCGAGGTTCTGAATTCCATCTATGGACCAGAAACTCTGTCGCGCGTGGAT
GACGATGGCCTCGATACTGGTAGGCCGACGACGTGGATTCTGCGCCTCCCGGGCGAGGCGTCGTCTCTGCGACTA
GGTTTCCCAGCGGCGTACCCAGCCGAGGCGCCAACCGTGCTAGGCACACATCATAGCTCAGGCGGGGTCCGAGGC
GCAGGGGCGCGAGACCTGGGTCTGCTTCAAGAGGCAATCGAGAGGGTTTTCCGAGCAGGAGAGGTTTGTCTGTAT
GATGCGGTGGAGGACGTGTGTGAGAGGCTTCGGGGGATGGAGGGACGAGCGCAAGCACCGGAAGAGCGGGAAGCT
GCCGGTGCTGCAACCGAGGCGAGAGACGCCACGAAGCTCGAGGGCTCGCAAAGCAAGGACGGAGACGCGGCAGGC
GACGAGCAAGACGACGACTCAGCGCCGGTGTGGACTATATCGGAGCCCATTGTTGAAAACAAATCGACCTTTGTG
GCGCGCGTAGCGACAGTGTCGAGCGCGGGGCAGGCAGCGCGATGCATCAGCCGCCTGGTGGGCTCGGAGCGGCGG
CTGCGTGACGCAACGCACAACATGTCGGCGTGGCGGGTGCGCGAGGCCGGCGTCGTCTGCCAGGACTGCGACGAC
GACGGAGAGACGGCAGCGGGGGCTCGTCTCTTGCACCTCATGCACCTCATGGGGGTGTGGGATGCCGTCGTGGTG
GTGTCGCGCTGGTACGGCGGCGTCAAGCTGGGGCCGCGTCGCTTCGCCCTCATCAACACGGCGGCGAGGGATGCG
TTTGTGCGGGCAGGCCTCGTCGAGGACAAGAAGCGGGCCAGGTGA
Gene >OphauG2|4787
ATGTCTGAGGAGCTCAAGGACGAGGTCGAGGTTCTGAATTCCATCTATGGACCAGAAACTCTGTCGCGCGTGGAT
GACGATGGCCTCGATACTGGTAGGCCGACGACGTGGATTCTGCGCCTCCCGGGCGAGGCGTCGTCTCTGCGACTA
GGTTTCCCAGCGGCGTACCCAGCCGAGGCGCCAACCGTGCTAGGCACACATCATAGCTCAGGCGGGGTCCGAGGC
GCAGGGGCGCGAGACCTGGGTCTGCTTCAAGAGGCAATCGAGAGGGTTTTCCGAGCAGGAGAGGTTTGTCTGTAT
GATGCGGTGGAGGACGTGTGTGAGAGGCTTCGGGGGATGGAGGGACGAGCGCAAGCACCGGAAGAGCGGGAAGCT
GCCGGTGCTGCAACCGAGGCGAGAGACGCCACGAAGCTCGAGGGCTCGCAAAGCAAGGACGGAGACGCGGCAGGC
GACGAGCAAGACGACGACTCAGCGCCGGTGTGGACTATATCGGAGCCCATTGTTGAAAACAAATCGACCTTTGTG
GCGCGCGTAGCGACAGTGTCGAGCGCGGGGCAGGCAGCGCGATGCATCAGCCGCCTGGTGGGCTCGGAGCGGCGG
CTGCGTGACGCAACGCACAACATGTCGGCGTGGCGGGTGCGCGAGGCCGGCGTCGTCTGCCAGGACTGCGACGAC
GACGGAGAGACGGCAGCGGGGGCTCGTCTCTTGCACCTCATGCACCTCATGGGGGTGTGGGATGCCGTCGTGGTG
GTGTCGCGCTGGTACGGCGGCGTCAAGCTGGGGCCGCGTCGCTTCGCCCTCATCAACACGGCGGCGAGGGATGCG
TTTGTGCGGGCAGGCCTCGTCGAGGACAAGAAGCGGGCCAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail