Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4786
Gene name
LocationContig_41:37041..38802
Strand+
Gene length (bp)1761
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13679 Methyltransf_32 Methyltransferase domain 3.8E-21 135 342

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8N6Q8|MET25_HUMAN Methyltransferase-like protein 25 OS=Homo sapiens GN=METTL25 PE=2 SV=2 282 583 2.0E-14

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2312
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4786 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7749
Ophiocordyceps camponoti-floridani Ophcf2|05835
Ophiocordyceps camponoti-rufipedis Ophun1|645
Ophiocordyceps kimflemingae Ophio5|5815
Ophiocordyceps subramaniannii Hirsu2|3099

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4786
MIIPPRNPLPHCGNFASPDDYISQLLDFASSSDLFQMLCGGVHVLDFFTTEPGLFHAVLPPEWHQFLLSCDSMRL
LDLLMRDHLDQLDFAPSQQPPESLLRYIRSVRNLSLRRDCDEKPDLAPLPRAVSVGMKPKKIHEVRCFADFVARL
SGPDVTHIVDLGSGQNYLGRALASEPYRRRVVAVEGRDNNVAAARELDRLSGLAVKEKVRRNKKLWNKILAARGS
DAEGDAEALAQAIRQIDGTDGFDFRPARELQSLYYGDEAKGTGCVQYVSGRLDSGDLGDVISSIDRGHDQGKEKL
GLMAVSIHSCGNLSHHGIRSLVLNPQMRAVAIVGCCYNLMTEKLGPPTYKHAYLRPSLQAVNGRVVRESERHDVH
GFPMSKAFSTHGGQGIRLNITARMMACQAPQNWSHDDSESFFTRHFFRAVLQRIFLDRGVVDRIWHRGPEAETSR
RSSPFDVSTSPVTIGSLRKPCYSSLRTYVRGAVDKLTTSTEYKQYADVMRQRMADMSDAEIDAYEAAYAPRRKEL
CVIWTLMAFSATVVEALIVADRWLFLAEQPDVVEHAWVQTVFEYAQSPRNLVVVGLRRNDA*
Coding >OphauG2|4786
ATGATTATCCCTCCTCGCAATCCTCTGCCCCATTGCGGCAACTTTGCATCCCCCGACGACTACATCAGCCAGCTG
CTCGACTTTGCCTCGTCCTCGGACCTCTTCCAGATGCTCTGCGGCGGTGTTCACGTCCTCGACTTCTTCACCACT
GAGCCCGGCCTCTTTCACGCCGTTTTGCCGCCAGAATGGCATCAGTTCCTTCTCTCGTGCGACTCTATGCGTCTG
CTTGACCTGCTGATGCGCGACCATCTCGACCAGCTCGATTTTGCTCCAAGCCAACAACCCCCCGAGAGCCTGCTG
CGCTACATACGCTCGGTTCGCAATCTTTCCTTGCGACGCGACTGCGACGAGAAGCCCGACCTGGCTCCTCTGCCC
CGGGCCGTCTCGGTTGGAATGAAGCCGAAAAAGATACACGAGGTGCGATGCTTTGCCGACTTTGTCGCCCGTCTT
TCTGGCCCCGACGTGACGCATATTGTCGACTTGGGCAGCGGCCAAAACTACCTGGGTAGAGCACTCGCCAGCGAG
CCGTACCGTCGACGTGTCGTTGCAGTCGAGGGCCGGGATAACAACGTGGCGGCAGCGCGTGAGCTTGACCGTCTC
TCTGGCCTGGCCGTCAAGGAAAAGGTGCGGCGTAACAAGAAGCTGTGGAACAAGATTCTCGCCGCTCGGGGGTCT
GACGCCGAGGGAGACGCCGAGGCGCTTGCGCAAGCCATCCGTCAAATCGACGGGACCGATGGCTTTGATTTCCGT
CCCGCCAGGGAGCTGCAGTCGCTATACTATGGCGATGAGGCCAAGGGCACAGGGTGTGTCCAGTACGTGTCGGGG
CGTCTCGACAGCGGCGACCTTGGCGACGTCATCTCGAGCATCGACCGAGGCCATGACCAAGGTAAAGAAAAGCTT
GGTCTCATGGCCGTCTCGATTCATTCTTGCGGCAACCTCTCTCACCACGGCATCCGGTCCCTTGTACTCAACCCA
CAGATGCGGGCCGTGGCCATTGTTGGCTGCTGCTACAACCTCATGACGGAGAAACTCGGCCCTCCAACCTACAAG
CACGCATACCTACGGCCAAGTCTGCAGGCCGTCAATGGACGTGTCGTGCGCGAGTCTGAGCGACACGACGTCCAC
GGCTTCCCCATGAGCAAGGCCTTTTCTACTCATGGTGGCCAGGGCATTCGTCTCAACATCACAGCGCGCATGATG
GCTTGTCAAGCACCTCAGAACTGGTCGCACGACGACAGCGAGTCTTTCTTTACTCGACACTTTTTCCGCGCCGTG
CTACAGCGTATATTTCTTGACCGGGGCGTCGTCGACCGCATTTGGCACCGCGGGCCCGAGGCAGAGACTAGCAGA
CGCAGCAGCCCCTTTGACGTTAGCACAAGCCCAGTCACGATTGGCTCGCTGCGCAAGCCGTGCTACTCGTCGCTG
CGCACCTACGTTCGCGGGGCCGTTGACAAGCTCACGACGAGCACCGAGTACAAGCAATATGCCGACGTGATGAGG
CAGCGCATGGCCGACATGAGCGACGCGGAAATCGACGCCTACGAAGCCGCCTATGCACCGCGTCGTAAGGAGCTG
TGTGTCATCTGGACTCTGATGGCATTCAGTGCCACGGTTGTCGAGGCGCTCATCGTCGCCGACCGCTGGCTCTTC
CTGGCAGAGCAGCCCGACGTGGTAGAGCACGCATGGGTCCAGACCGTCTTTGAATATGCCCAGAGCCCGCGAAAC
CTGGTTGTTGTTGGTCTTCGGCGTAATGATGCTTGA
Transcript >OphauG2|4786
ATGATTATCCCTCCTCGCAATCCTCTGCCCCATTGCGGCAACTTTGCATCCCCCGACGACTACATCAGCCAGCTG
CTCGACTTTGCCTCGTCCTCGGACCTCTTCCAGATGCTCTGCGGCGGTGTTCACGTCCTCGACTTCTTCACCACT
GAGCCCGGCCTCTTTCACGCCGTTTTGCCGCCAGAATGGCATCAGTTCCTTCTCTCGTGCGACTCTATGCGTCTG
CTTGACCTGCTGATGCGCGACCATCTCGACCAGCTCGATTTTGCTCCAAGCCAACAACCCCCCGAGAGCCTGCTG
CGCTACATACGCTCGGTTCGCAATCTTTCCTTGCGACGCGACTGCGACGAGAAGCCCGACCTGGCTCCTCTGCCC
CGGGCCGTCTCGGTTGGAATGAAGCCGAAAAAGATACACGAGGTGCGATGCTTTGCCGACTTTGTCGCCCGTCTT
TCTGGCCCCGACGTGACGCATATTGTCGACTTGGGCAGCGGCCAAAACTACCTGGGTAGAGCACTCGCCAGCGAG
CCGTACCGTCGACGTGTCGTTGCAGTCGAGGGCCGGGATAACAACGTGGCGGCAGCGCGTGAGCTTGACCGTCTC
TCTGGCCTGGCCGTCAAGGAAAAGGTGCGGCGTAACAAGAAGCTGTGGAACAAGATTCTCGCCGCTCGGGGGTCT
GACGCCGAGGGAGACGCCGAGGCGCTTGCGCAAGCCATCCGTCAAATCGACGGGACCGATGGCTTTGATTTCCGT
CCCGCCAGGGAGCTGCAGTCGCTATACTATGGCGATGAGGCCAAGGGCACAGGGTGTGTCCAGTACGTGTCGGGG
CGTCTCGACAGCGGCGACCTTGGCGACGTCATCTCGAGCATCGACCGAGGCCATGACCAAGGTAAAGAAAAGCTT
GGTCTCATGGCCGTCTCGATTCATTCTTGCGGCAACCTCTCTCACCACGGCATCCGGTCCCTTGTACTCAACCCA
CAGATGCGGGCCGTGGCCATTGTTGGCTGCTGCTACAACCTCATGACGGAGAAACTCGGCCCTCCAACCTACAAG
CACGCATACCTACGGCCAAGTCTGCAGGCCGTCAATGGACGTGTCGTGCGCGAGTCTGAGCGACACGACGTCCAC
GGCTTCCCCATGAGCAAGGCCTTTTCTACTCATGGTGGCCAGGGCATTCGTCTCAACATCACAGCGCGCATGATG
GCTTGTCAAGCACCTCAGAACTGGTCGCACGACGACAGCGAGTCTTTCTTTACTCGACACTTTTTCCGCGCCGTG
CTACAGCGTATATTTCTTGACCGGGGCGTCGTCGACCGCATTTGGCACCGCGGGCCCGAGGCAGAGACTAGCAGA
CGCAGCAGCCCCTTTGACGTTAGCACAAGCCCAGTCACGATTGGCTCGCTGCGCAAGCCGTGCTACTCGTCGCTG
CGCACCTACGTTCGCGGGGCCGTTGACAAGCTCACGACGAGCACCGAGTACAAGCAATATGCCGACGTGATGAGG
CAGCGCATGGCCGACATGAGCGACGCGGAAATCGACGCCTACGAAGCCGCCTATGCACCGCGTCGTAAGGAGCTG
TGTGTCATCTGGACTCTGATGGCATTCAGTGCCACGGTTGTCGAGGCGCTCATCGTCGCCGACCGCTGGCTCTTC
CTGGCAGAGCAGCCCGACGTGGTAGAGCACGCATGGGTCCAGACCGTCTTTGAATATGCCCAGAGCCCGCGAAAC
CTGGTTGTTGTTGGTCTTCGGCGTAATGATGCTTGA
Gene >OphauG2|4786
ATGATTATCCCTCCTCGCAATCCTCTGCCCCATTGCGGCAACTTTGCATCCCCCGACGACTACATCAGCCAGCTG
CTCGACTTTGCCTCGTCCTCGGACCTCTTCCAGATGCTCTGCGGCGGTGTTCACGTCCTCGACTTCTTCACCACT
GAGCCCGGCCTCTTTCACGCCGTTTTGCCGCCAGAATGGCATCAGTTCCTTCTCTCGTGCGACTCTATGCGTCTG
CTTGACCTGCTGATGCGCGACCATCTCGACCAGCTCGATTTTGCTCCAAGCCAACAACCCCCCGAGAGCCTGCTG
CGCTACATACGCTCGGTTCGCAATCTTTCCTTGCGACGCGACTGCGACGAGAAGCCCGACCTGGCTCCTCTGCCC
CGGGCCGTCTCGGTTGGAATGAAGCCGAAAAAGATACACGAGGTGCGATGCTTTGCCGACTTTGTCGCCCGTCTT
TCTGGCCCCGACGTGACGCATATTGTCGACTTGGGCAGCGGCCAAAACTACCTGGGTAGAGCACTCGCCAGCGAG
CCGTACCGTCGACGTGTCGTTGCAGTCGAGGGCCGGGATAACAACGTGGCGGCAGCGCGTGAGCTTGACCGTCTC
TCTGGCCTGGCCGTCAAGGAAAAGGTGCGGCGTAACAAGAAGCTGTGGAACAAGATTCTCGCCGCTCGGGGGTCT
GACGCCGAGGGAGACGCCGAGGCGCTTGCGCAAGCCATCCGTCAAATCGACGGGACCGATGGCTTTGATTTCCGT
CCCGCCAGGGAGCTGCAGTCGCTATACTATGGCGATGAGGCCAAGGGCACAGGGTGTGTCCAGTACGTGTCGGGG
CGTCTCGACAGCGGCGACCTTGGCGACGTCATCTCGAGCATCGACCGAGGCCATGACCAAGGTAAAGAAAAGCTT
GGTCTCATGGCCGTCTCGATTCATTCTTGCGGCAACCTCTCTCACCACGGCATCCGGTCCCTTGTACTCAACCCA
CAGATGCGGGCCGTGGCCATTGTTGGCTGCTGCTACAACCTCATGACGGAGAAACTCGGCCCTCCAACCTACAAG
CACGCATACCTACGGCCAAGTCTGCAGGCCGTCAATGGACGTGTCGTGCGCGAGTCTGAGCGACACGACGTCCAC
GGCTTCCCCATGAGCAAGGCCTTTTCTACTCATGGTGGCCAGGGCATTCGTCTCAACATCACAGCGCGCATGATG
GCTTGTCAAGCACCTCAGAACTGGTCGCACGACGACAGCGAGTCTTTCTTTACTCGACACTTTTTCCGCGCCGTG
CTACAGCGTATATTTCTTGACCGGGGCGTCGTCGACCGCATTTGGCACCGCGGGCCCGAGGCAGAGACTAGCAGA
CGCAGCAGCCCCTTTGACGTTAGCACAAGCCCAGTCACGATTGGCTCGCTGCGCAAGCCGTGCTACTCGTCGCTG
CGCACCTACGTTCGCGGGGCCGTTGACAAGCTCACGACGAGCACCGAGTACAAGCAATATGCCGACGTGATGAGG
CAGCGCATGGCCGACATGAGCGACGCGGAAATCGACGCCTACGAAGCCGCCTATGCACCGCGTCGTAAGGAGCTG
TGTGTCATCTGGACTCTGATGGCATTCAGTGCCACGGTTGTCGAGGCGCTCATCGTCGCCGACCGCTGGCTCTTC
CTGGCAGAGCAGCCCGACGTGGTAGAGCACGCATGGGTCCAGACCGTCTTTGAATATGCCCAGAGCCCGCGAAAC
CTGGTTGTTGTTGGTCTTCGGCGTAATGATGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail