Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4783
Gene name
LocationContig_41:26653..30992
Strand-
Gene length (bp)4339
Transcript length (bp)4095
Coding sequence length (bp)4095
Protein length (aa) 1365

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 3.8E-76 747 1080
PF17877 Dis3l2_C_term DIS3-like exonuclease 2 C terminal 1.5E-25 1132 1211
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 9.1E-26 640 715

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 418 1362 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 155 1363 0.0E+00
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 416 1184 2.0E-142
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 418 1187 8.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 417 1185 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 418 1362 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 155 1363 0.0E+00
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 416 1184 2.0E-142
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 418 1187 8.0E-142
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 417 1185 2.0E-102
sp|Q8CI75|DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus GN=Dis3l2 PE=1 SV=1 417 1185 3.0E-96
sp|Q0V9R3|DI3L2_XENTR DIS3-like exonuclease 2 OS=Xenopus tropicalis GN=dis3l2 PE=2 SV=2 421 1185 1.0E-95
sp|Q09568|DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans GN=F48E8.6 PE=3 SV=2 419 1212 1.0E-89
sp|O14040|DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis32 PE=1 SV=1 554 1161 2.0E-83
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 642 1162 5.0E-67
sp|Q8TF46|DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens GN=DIS3L PE=1 SV=2 644 1158 7.0E-66
sp|A0JN80|DI3L1_BOVIN DIS3-like exonuclease 1 OS=Bos taurus GN=DIS3L PE=2 SV=2 644 1158 9.0E-66
sp|Q5U2P0|DI3L1_RAT DIS3-like exonuclease 1 OS=Rattus norvegicus GN=Dis3l PE=2 SV=2 644 1158 1.0E-65
sp|Q5R5N8|DI3L1_PONAB DIS3-like exonuclease 1 OS=Pongo abelii GN=DIS3L PE=2 SV=1 644 1158 1.0E-65
sp|P0DM58|DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana GN=SOV PE=1 SV=1 366 1187 3.0E-65
sp|Q8C0S1|DI3L1_MOUSE DIS3-like exonuclease 1 OS=Mus musculus GN=Dis3l PE=1 SV=2 644 1158 7.0E-65
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 419 1161 1.0E-64
sp|Q0WPN0|DI32L_ARATH Inactive exonuclease DIS3L2 OS=Arabidopsis thaliana GN=SOV PE=2 SV=1 366 1187 5.0E-64
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 631 1162 3.0E-63
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 422 1166 6.0E-62
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 640 1166 9.0E-61
sp|Q6GN11|DI3L1_XENLA DIS3-like exonuclease 1 OS=Xenopus laevis GN=dis3l PE=2 SV=2 640 1158 6.0E-60
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 642 1190 7.0E-60
sp|Q17632|RRP44_CAEEL Probable exosome complex exonuclease RRP44 OS=Caenorhabditis elegans GN=dis-3 PE=3 SV=2 419 1161 1.0E-59
sp|Q0P4R5|DI3L1_XENTR DIS3-like exonuclease 1 OS=Xenopus tropicalis GN=dis3l PE=2 SV=2 640 1158 2.0E-59
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 740 1132 1.0E-44
sp|Q9WZI1|RNR_THEMA Ribonuclease R OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rnr PE=3 SV=1 676 1166 4.0E-41
sp|O84402|RNR_CHLTR Ribonuclease R OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnr PE=3 SV=1 693 1219 6.0E-41
sp|Q9PK00|RNR_CHLMU Ribonuclease R OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnr PE=3 SV=1 693 1192 8.0E-39
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr1 PE=3 SV=1 741 1075 1.0E-38
sp|Q9Z848|RNR_CHLPN Ribonuclease R OS=Chlamydia pneumoniae GN=rnr PE=3 SV=1 693 1167 7.0E-37
sp|O67834|RNR_AQUAE Ribonuclease R OS=Aquifex aeolicus (strain VF5) GN=rnr PE=3 SV=1 674 1123 4.0E-35
sp|P40611|RNR_VIBPA Ribonuclease R OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnr PE=3 SV=2 747 1173 2.0E-27
sp|Q02146|RNR2_LACLA Ribonuclease R 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr2 PE=3 SV=3 741 1075 3.0E-27
sp|Q9KNY1|RNR_VIBCH Ribonuclease R OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnr PE=3 SV=1 741 1166 7.0E-27
sp|Q98QL0|RNR_MYCPU Ribonuclease R OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rnr PE=3 SV=1 663 1076 7.0E-25
sp|Q9PR88|RNR_UREPA Ribonuclease R OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rnr PE=3 SV=1 740 1075 1.0E-24
sp|P47350|RNR_MYCGE Ribonuclease R OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rnr PE=3 SV=1 697 1181 8.0E-24
sp|P21499|RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) GN=rnr PE=1 SV=2 747 1166 2.0E-23
sp|P30851|RNR_SHIFL Ribonuclease R OS=Shigella flexneri GN=rnr PE=3 SV=4 747 1166 5.0E-23
sp|P44907|RNR_HAEIN Ribonuclease R OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnr PE=3 SV=1 689 1088 1.0E-22
sp|P75529|RNR_MYCPN Ribonuclease R OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rnr PE=3 SV=1 738 1159 6.0E-21
sp|P57628|RNR_BUCAI Ribonuclease R OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnr PE=3 SV=2 740 1166 7.0E-20
sp|Q46363|ZAM_SYNY3 Acetazolamide conferring resistance protein zam OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zam PE=3 SV=1 781 1180 2.0E-19
sp|Q8K917|RNR_BUCAP Ribonuclease R OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnr PE=3 SV=1 740 1166 3.0E-18
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 730 1079 6.0E-17
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 730 1079 2.0E-16
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 730 1079 2.0E-16
sp|Q87IJ9|RNB_VIBPA Exoribonuclease 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnb PE=3 SV=1 730 1079 7.0E-16
sp|C3LW69|RNB_VIBCM Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnb PE=3 SV=1 730 1081 8.0E-14
sp|Q9KLE1|RNB_VIBCH Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnb PE=3 SV=1 730 1081 8.0E-14
sp|A5F0G1|RNB_VIBC3 Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnb PE=3 SV=1 730 1081 2.0E-13
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 745 1087 2.0E-13
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 666 1079 3.0E-13
sp|D3V184|RNB_XENBS Exoribonuclease 2 OS=Xenorhabdus bovienii (strain SS-2004) GN=rnb PE=3 SV=1 740 1079 7.0E-13
sp|P54084|RNR_ACIFR Ribonuclease R (Fragment) OS=Acidithiobacillus ferrooxidans GN=rnr PE=3 SV=2 644 910 4.0E-12
sp|A1SWZ6|RNB_PSYIN Exoribonuclease 2 OS=Psychromonas ingrahamii (strain 37) GN=rnb PE=3 SV=1 746 1079 9.0E-12
sp|A7FI01|RNB_YERP3 Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rnb PE=3 SV=1 747 1085 1.0E-11
sp|Q2NST6|RNB_SODGM Exoribonuclease 2 OS=Sodalis glossinidius (strain morsitans) GN=rnb PE=3 SV=1 746 1085 1.0E-11
sp|Q1LTG8|RNB_BAUCH Exoribonuclease 2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rnb PE=3 SV=1 747 1085 2.0E-11
sp|Q1C7L1|RNB_YERPA Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|B1JKP2|RNB_YERPY Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|B2K4J2|RNB_YERPB Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|Q66AH3|RNB_YERPS Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|Q8ZED8|RNB_YERPE Exoribonuclease 2 OS=Yersinia pestis GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|A9R8T9|RNB_YERPG Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|Q1CIZ7|RNB_YERPN Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|A4TJ37|RNB_YERPP Exoribonuclease 2 OS=Yersinia pestis (strain Pestoides F) GN=rnb PE=3 SV=1 747 1085 3.0E-11
sp|Q7N4F5|RNB_PHOLL Exoribonuclease 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnb PE=3 SV=1 747 1085 1.0E-10
sp|A4WAX5|RNB_ENT38 Exoribonuclease 2 OS=Enterobacter sp. (strain 638) GN=rnb PE=3 SV=1 747 1084 1.0E-10
sp|A1JM34|RNB_YERE8 Exoribonuclease 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rnb PE=3 SV=1 747 1085 2.0E-10
sp|Q1RC77|RNB_ECOUT Exoribonuclease 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=rnb PE=3 SV=1 747 1081 1.0E-09
sp|Q0TI78|RNB_ECOL5 Exoribonuclease 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rnb PE=3 SV=1 747 1081 2.0E-09
sp|B7UR96|RNB_ECO27 Exoribonuclease 2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rnb PE=3 SV=1 747 1081 2.0E-09
sp|Q8FHT6|RNB_ECOL6 Exoribonuclease 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rnb PE=3 SV=1 747 1081 2.0E-09
sp|A7MMD8|RNB_CROS8 Exoribonuclease 2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rnb PE=3 SV=1 746 1081 2.0E-09
sp|A1AAQ4|RNB_ECOK1 Exoribonuclease 2 OS=Escherichia coli O1:K1 / APEC GN=rnb PE=3 SV=1 747 1081 3.0E-09
sp|B7MLW3|RNB_ECO45 Exoribonuclease 2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rnb PE=3 SV=1 747 1081 3.0E-09
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 747 872 3.0E-09
sp|Q31ZY2|RNB_SHIBS Exoribonuclease 2 OS=Shigella boydii serotype 4 (strain Sb227) GN=rnb PE=3 SV=1 747 1081 1.0E-08
sp|B2U0I4|RNB_SHIB3 Exoribonuclease 2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rnb PE=3 SV=1 747 1081 1.0E-08
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 747 880 3.0E-08
sp|P56123|RNR_HELPY Ribonuclease R OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rnr PE=3 SV=1 782 1079 4.0E-08
sp|Q9ZJX9|RNR_HELPJ Ribonuclease R OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnr PE=3 SV=1 782 1079 6.0E-07
sp|Q7VLX8|RNB_HAEDU Exoribonuclease 2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rnb PE=3 SV=1 747 1079 9.0E-07
sp|P39112|DSS1_YEAST Exoribonuclease II, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSS1 PE=1 SV=2 745 1099 2.0E-06
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 411 496 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004540 ribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0004518 nuclease activity No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140098 catalytic activity, acting on RNA No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1152
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4783 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7752
Ophiocordyceps camponoti-floridani Ophcf2|05838
Ophiocordyceps camponoti-rufipedis Ophun1|648
Ophiocordyceps kimflemingae Ophio5|5818
Ophiocordyceps subramaniannii Hirsu2|10234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4783
MEQQQQQQNKSQQQQPGHGQPAGNVPGPAGRRLHIAHRRSPSELTPLMSMFAANPGIEQLAIQQQIELLQQQQQQ
LQATHQQYVNLGMLPPGQPMAHNGAFNPLQPMANMPQNAFQFPNQIPQQNMAMAPPTQPLSHRRNQSALPNMGMG
MGGPPPAPSSGASGSNFGNFEAPGAHGRENTGGRGGRGGGGASSHQRRHSLALADAKKAAEIAQQKRTTTGFQFP
GPAASSGKIDDENSKMAATHSNLDASVAHGSTRGRGGHGRSQSMATNGRGGTRIAPDAGGDFHRRGGGGGGGHAR
TGSRSFEGNWRTQNQNQDQSGNVNQAFQPGHRPRGSVSQSVSSIGAFQYNPSQPQLMQIPGQIVMPQMFGQQLNA
MQMNQLQALQAAQMNGQQFQGLQNSQHAGPMGNQQQQQQQQQRKTLFTPYLPQASLPALLGDGQLVSGILRVNKK
NRSDAYVTTQDGLLDADIFICGSKDRNRALEGDLVAVELLDVDEVWSQKREKEEKKKRKDITDTRSGSTSQGNHN
SGQNDDGNTAEGGIRRRGSLRQRPTQKKNDDVEVEGQSLLLVEEEEINDEQKPLYAGHIVAVIERVAGQMFSGTL
GLLRPSSQATKEKQEAERAARDGGNSRHNDTRQPEKPKIVWFKPTDKRVPLIAIPTEQAPRDFVDKHQDYADRIF
VACIKRWPITSLHPFGTLVEQLGRMGDLKVETDALLRDNNFSSDEFSDAVLRSVGFQDWTLANEDETSIESRRDF
REEQVFTVDFNGSVELGNAVHIKTGPDGKIEVGIHVPDVAHFVKPNSLVDREAKKRGTSVQLLNRFCALLPPKLS
GELCSLLPQEDRLTVSVVFNVNPHTGAVAEGDGWVGRSIIKSAGKLSLKDIDRALGDPTTFSSGAATSKTIQILQ
GVAQKFREARLGAGGEPIAPLRLFRQLDDENNPVQENIFDSTPALELVEELMQKANAYVAQRLAEGLPEKALLRR
QASPNPRRLQTFVERMTALGYDVDASGSGALQNSLFKIDDAELRKGMETLVLKSMHRAKYFIAGKTAKPLWPHYC
LNLPLYTHFTSPTRRYADILVHRQLEAALSGGKIEFTDDMESLVKTVESCNTKKDSAQNAQEQSIHIESCRTMDK
KRQEVNGDLISEGVVLCVYESAFDVLIPEWGFEKRVHCDQLPLKKAEFRKEKRVLELYWEKGVPSSAYVPEDERP
KAASSQRVSNAMAAARQAEEAEKAKKEREEAARKQTETGTMSTDDVEALFDDEEDNMSDVTEAMAGVSLAERPTQ
SVPGSPARTSSNAGTLHRTRSDSKVPISETVEGRLTNKERYLDLFKLREEGGDYIQDVTEMTRLPIILKTDLSKS
PPCLTIRSLNPYAL*
Coding >OphauG2|4783
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCGCAACAGCAGCAACCGGGCCATGGCCAGCCCGCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGACTGCACATTGCCCATCGACGGAGCCCCTCGGAGCTGACCCCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAATTGAACAGTTGGCAATTCAGCAACAGATCGAGCTTTTACAGCAGCAGCAGCAGCAG
CTCCAGGCTACCCATCAGCAATATGTCAACCTGGGCATGCTGCCCCCGGGCCAGCCCATGGCCCACAACGGCGCT
TTCAATCCTTTGCAGCCCATGGCCAACATGCCTCAGAATGCTTTTCAATTCCCAAACCAGATTCCTCAACAAAAC
ATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCAGCCCTACCCAATATGGGCATGGGC
ATGGGCGGCCCACCCCCTGCACCTTCCTCCGGCGCCTCGGGTTCCAATTTTGGCAACTTTGAGGCTCCCGGTGCC
CATGGCAGAGAAAATACTGGCGGCCGAGGCGGCCGAGGCGGAGGCGGAGCCTCGAGTCACCAGCGAAGACATTCT
TTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTACCGGATTCCAATTCCCC
GGTCCTGCTGCCTCGTCTGGCAAAATCGACGACGAGAATAGCAAAATGGCCGCCACTCATTCCAACCTTGACGCC
TCTGTCGCCCACGGCTCAACCCGTGGCCGCGGAGGACATGGCCGCAGTCAGAGTATGGCTACCAATGGTCGTGGA
GGCACTCGCATCGCCCCCGATGCTGGCGGCGACTTTCACCGACGCGGCGGCGGCGGCGGCGGCGGTCATGCCCGT
ACTGGATCCCGGAGTTTTGAGGGCAATTGGCGCACTCAAAATCAGAATCAAGACCAGTCTGGCAATGTGAACCAG
GCTTTTCAGCCCGGCCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTTTCAATACAAC
CCAAGCCAGCCTCAACTCATGCAAATCCCAGGCCAAATTGTGATGCCACAGATGTTTGGCCAGCAGCTCAATGCT
ATGCAGATGAATCAGTTGCAGGCTCTCCAGGCGGCTCAGATGAATGGACAGCAGTTTCAAGGTCTGCAGAACTCT
CAGCATGCGGGACCAATGGGGAACCAACAGCAACAACAGCAACAACAGCAGCGCAAGACGCTCTTCACGCCATAT
TTGCCCCAGGCCTCCCTCCCTGCCCTATTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAACAAGAAG
AATCGCAGCGACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCCGACATCTTTATTTGCGGTAGCAAGGAC
CGCAACCGAGCCCTCGAGGGCGACCTGGTGGCTGTCGAACTCCTTGATGTTGATGAGGTTTGGTCTCAGAAGCGA
GAGAAGGAGGAAAAGAAGAAGCGAAAGGACATCACGGACACTCGTTCTGGTTCAACAAGTCAAGGCAATCACAAT
TCTGGTCAGAATGACGATGGAAACACTGCTGAGGGTGGCATACGCCGCCGAGGTAGTCTGCGTCAGCGTCCGACC
CAAAAGAAAAACGACGACGTTGAAGTTGAAGGCCAGAGTCTTCTTTTGGTGGAAGAAGAAGAAATCAATGATGAG
CAGAAGCCTCTGTACGCTGGCCACATTGTCGCGGTTATTGAGCGCGTGGCTGGACAAATGTTTTCGGGAACCCTG
GGACTGTTACGGCCTAGCAGCCAGGCTACCAAGGAGAAACAGGAGGCTGAAAGAGCTGCCAGAGATGGTGGCAAC
AGTCGTCACAATGACACTCGACAGCCAGAGAAGCCAAAGATTGTATGGTTCAAGCCAACGGACAAGCGAGTCCCC
TTGATTGCTATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGACTATGCTGATCGCATTTTT
GTGGCCTGCATCAAGCGATGGCCAATCACGTCACTACATCCCTTTGGCACTTTAGTGGAACAGCTGGGCCGCATG
GGTGACCTTAAGGTGGAAACCGATGCCCTGCTACGAGACAACAACTTTTCGTCTGATGAATTTTCGGATGCTGTG
CTTCGAAGCGTTGGCTTCCAGGACTGGACCTTGGCCAATGAAGACGAGACGTCGATAGAATCTCGCCGTGATTTC
CGCGAGGAACAAGTCTTTACAGTCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCATATCAAGACTGGT
CCCGACGGCAAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCTTGTCGAC
AGAGAGGCCAAGAAGCGTGGTACGTCGGTGCAGCTACTCAACCGGTTCTGTGCCTTGCTTCCGCCCAAGCTGTCT
GGTGAGCTTTGTTCTCTGCTGCCTCAAGAGGATCGCTTGACAGTCAGCGTTGTATTCAATGTGAATCCTCACACT
GGCGCCGTGGCCGAGGGTGATGGCTGGGTTGGACGCAGCATCATCAAGAGCGCAGGCAAACTGTCACTCAAAGAC
ATTGACAGGGCGCTTGGTGATCCGACAACCTTTTCGAGCGGAGCGGCCACGAGCAAGACTATTCAGATTCTGCAA
GGGGTGGCCCAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGTGAACCGATTGCACCGCTACGTCTCTTTCGC
CAACTCGACGACGAGAACAACCCTGTACAGGAAAATATATTTGACTCGACGCCCGCGCTGGAGCTGGTTGAGGAG
CTTATGCAAAAGGCAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCCCTTCTTCGCCGC
CAGGCCTCTCCCAATCCCCGTCGCCTTCAGACATTTGTCGAGCGCATGACGGCTCTTGGCTACGATGTGGACGCG
TCGGGAAGCGGAGCTCTCCAGAACAGCTTGTTCAAGATTGATGACGCGGAGCTTCGCAAGGGCATGGAAACACTG
GTGCTCAAGTCGATGCACCGAGCCAAGTACTTCATTGCAGGCAAGACTGCCAAGCCATTGTGGCCGCACTACTGC
CTCAATCTGCCGCTTTACACACATTTCACGAGCCCGACGCGTCGCTACGCGGACATCTTGGTTCACCGACAGCTC
GAGGCTGCTTTATCAGGGGGCAAGATTGAATTTACAGATGACATGGAAAGCCTGGTCAAGACTGTCGAGTCGTGC
AACACCAAGAAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATCGAGTCGTGTCGCACAATGGACAAG
AAGCGGCAAGAGGTCAATGGTGACCTGATATCCGAAGGTGTCGTGCTGTGTGTTTACGAGTCAGCCTTTGATGTG
CTGATCCCAGAGTGGGGGTTTGAGAAGCGGGTGCACTGCGACCAGCTCCCACTCAAGAAGGCTGAATTTAGAAAG
GAGAAGCGAGTGCTCGAGCTGTACTGGGAGAAGGGAGTGCCAAGCTCTGCGTACGTGCCCGAGGACGAGCGGCCA
AAGGCAGCATCATCACAGCGGGTTTCCAATGCCATGGCTGCGGCACGGCAGGCAGAAGAGGCGGAAAAGGCCAAG
AAGGAGCGAGAAGAGGCGGCCCGCAAGCAGACTGAAACTGGCACCATGTCGACGGACGATGTCGAGGCACTCTTT
GACGATGAGGAGGACAACATGTCGGACGTGACTGAGGCCATGGCTGGAGTGTCGCTGGCGGAGCGGCCGACGCAG
AGCGTGCCCGGATCGCCGGCGCGCACATCTTCGAATGCTGGCACGCTACATCGAACCCGGTCTGACTCCAAGGTG
CCAATCTCGGAGACGGTTGAGGGACGCCTCACCAACAAGGAACGATACCTTGATCTGTTCAAGTTGCGGGAAGAG
GGCGGCGACTACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATCATTTTGAAGACGGACCTCAGCAAGAGC
CCGCCATGTCTGACCATCCGTTCCCTGAATCCGTATGCCCTGTAA
Transcript >OphauG2|4783
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCGCAACAGCAGCAACCGGGCCATGGCCAGCCCGCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGACTGCACATTGCCCATCGACGGAGCCCCTCGGAGCTGACCCCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAATTGAACAGTTGGCAATTCAGCAACAGATCGAGCTTTTACAGCAGCAGCAGCAGCAG
CTCCAGGCTACCCATCAGCAATATGTCAACCTGGGCATGCTGCCCCCGGGCCAGCCCATGGCCCACAACGGCGCT
TTCAATCCTTTGCAGCCCATGGCCAACATGCCTCAGAATGCTTTTCAATTCCCAAACCAGATTCCTCAACAAAAC
ATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCAGCCCTACCCAATATGGGCATGGGC
ATGGGCGGCCCACCCCCTGCACCTTCCTCCGGCGCCTCGGGTTCCAATTTTGGCAACTTTGAGGCTCCCGGTGCC
CATGGCAGAGAAAATACTGGCGGCCGAGGCGGCCGAGGCGGAGGCGGAGCCTCGAGTCACCAGCGAAGACATTCT
TTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTACCGGATTCCAATTCCCC
GGTCCTGCTGCCTCGTCTGGCAAAATCGACGACGAGAATAGCAAAATGGCCGCCACTCATTCCAACCTTGACGCC
TCTGTCGCCCACGGCTCAACCCGTGGCCGCGGAGGACATGGCCGCAGTCAGAGTATGGCTACCAATGGTCGTGGA
GGCACTCGCATCGCCCCCGATGCTGGCGGCGACTTTCACCGACGCGGCGGCGGCGGCGGCGGCGGTCATGCCCGT
ACTGGATCCCGGAGTTTTGAGGGCAATTGGCGCACTCAAAATCAGAATCAAGACCAGTCTGGCAATGTGAACCAG
GCTTTTCAGCCCGGCCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTTTCAATACAAC
CCAAGCCAGCCTCAACTCATGCAAATCCCAGGCCAAATTGTGATGCCACAGATGTTTGGCCAGCAGCTCAATGCT
ATGCAGATGAATCAGTTGCAGGCTCTCCAGGCGGCTCAGATGAATGGACAGCAGTTTCAAGGTCTGCAGAACTCT
CAGCATGCGGGACCAATGGGGAACCAACAGCAACAACAGCAACAACAGCAGCGCAAGACGCTCTTCACGCCATAT
TTGCCCCAGGCCTCCCTCCCTGCCCTATTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGTCAACAAGAAG
AATCGCAGCGACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCCGACATCTTTATTTGCGGTAGCAAGGAC
CGCAACCGAGCCCTCGAGGGCGACCTGGTGGCTGTCGAACTCCTTGATGTTGATGAGGTTTGGTCTCAGAAGCGA
GAGAAGGAGGAAAAGAAGAAGCGAAAGGACATCACGGACACTCGTTCTGGTTCAACAAGTCAAGGCAATCACAAT
TCTGGTCAGAATGACGATGGAAACACTGCTGAGGGTGGCATACGCCGCCGAGGTAGTCTGCGTCAGCGTCCGACC
CAAAAGAAAAACGACGACGTTGAAGTTGAAGGCCAGAGTCTTCTTTTGGTGGAAGAAGAAGAAATCAATGATGAG
CAGAAGCCTCTGTACGCTGGCCACATTGTCGCGGTTATTGAGCGCGTGGCTGGACAAATGTTTTCGGGAACCCTG
GGACTGTTACGGCCTAGCAGCCAGGCTACCAAGGAGAAACAGGAGGCTGAAAGAGCTGCCAGAGATGGTGGCAAC
AGTCGTCACAATGACACTCGACAGCCAGAGAAGCCAAAGATTGTATGGTTCAAGCCAACGGACAAGCGAGTCCCC
TTGATTGCTATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGACTATGCTGATCGCATTTTT
GTGGCCTGCATCAAGCGATGGCCAATCACGTCACTACATCCCTTTGGCACTTTAGTGGAACAGCTGGGCCGCATG
GGTGACCTTAAGGTGGAAACCGATGCCCTGCTACGAGACAACAACTTTTCGTCTGATGAATTTTCGGATGCTGTG
CTTCGAAGCGTTGGCTTCCAGGACTGGACCTTGGCCAATGAAGACGAGACGTCGATAGAATCTCGCCGTGATTTC
CGCGAGGAACAAGTCTTTACAGTCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCATATCAAGACTGGT
CCCGACGGCAAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTCTCTTGTCGAC
AGAGAGGCCAAGAAGCGTGGTACGTCGGTGCAGCTACTCAACCGGTTCTGTGCCTTGCTTCCGCCCAAGCTGTCT
GGTGAGCTTTGTTCTCTGCTGCCTCAAGAGGATCGCTTGACAGTCAGCGTTGTATTCAATGTGAATCCTCACACT
GGCGCCGTGGCCGAGGGTGATGGCTGGGTTGGACGCAGCATCATCAAGAGCGCAGGCAAACTGTCACTCAAAGAC
ATTGACAGGGCGCTTGGTGATCCGACAACCTTTTCGAGCGGAGCGGCCACGAGCAAGACTATTCAGATTCTGCAA
GGGGTGGCCCAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGTGAACCGATTGCACCGCTACGTCTCTTTCGC
CAACTCGACGACGAGAACAACCCTGTACAGGAAAATATATTTGACTCGACGCCCGCGCTGGAGCTGGTTGAGGAG
CTTATGCAAAAGGCAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCCCTTCTTCGCCGC
CAGGCCTCTCCCAATCCCCGTCGCCTTCAGACATTTGTCGAGCGCATGACGGCTCTTGGCTACGATGTGGACGCG
TCGGGAAGCGGAGCTCTCCAGAACAGCTTGTTCAAGATTGATGACGCGGAGCTTCGCAAGGGCATGGAAACACTG
GTGCTCAAGTCGATGCACCGAGCCAAGTACTTCATTGCAGGCAAGACTGCCAAGCCATTGTGGCCGCACTACTGC
CTCAATCTGCCGCTTTACACACATTTCACGAGCCCGACGCGTCGCTACGCGGACATCTTGGTTCACCGACAGCTC
GAGGCTGCTTTATCAGGGGGCAAGATTGAATTTACAGATGACATGGAAAGCCTGGTCAAGACTGTCGAGTCGTGC
AACACCAAGAAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATCGAGTCGTGTCGCACAATGGACAAG
AAGCGGCAAGAGGTCAATGGTGACCTGATATCCGAAGGTGTCGTGCTGTGTGTTTACGAGTCAGCCTTTGATGTG
CTGATCCCAGAGTGGGGGTTTGAGAAGCGGGTGCACTGCGACCAGCTCCCACTCAAGAAGGCTGAATTTAGAAAG
GAGAAGCGAGTGCTCGAGCTGTACTGGGAGAAGGGAGTGCCAAGCTCTGCGTACGTGCCCGAGGACGAGCGGCCA
AAGGCAGCATCATCACAGCGGGTTTCCAATGCCATGGCTGCGGCACGGCAGGCAGAAGAGGCGGAAAAGGCCAAG
AAGGAGCGAGAAGAGGCGGCCCGCAAGCAGACTGAAACTGGCACCATGTCGACGGACGATGTCGAGGCACTCTTT
GACGATGAGGAGGACAACATGTCGGACGTGACTGAGGCCATGGCTGGAGTGTCGCTGGCGGAGCGGCCGACGCAG
AGCGTGCCCGGATCGCCGGCGCGCACATCTTCGAATGCTGGCACGCTACATCGAACCCGGTCTGACTCCAAGGTG
CCAATCTCGGAGACGGTTGAGGGACGCCTCACCAACAAGGAACGATACCTTGATCTGTTCAAGTTGCGGGAAGAG
GGCGGCGACTACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATCATTTTGAAGACGGACCTCAGCAAGAGC
CCGCCATGTCTGACCATCCGTTCCCTGAATCCGTATGCCCTGTAA
Gene >OphauG2|4783
ATGGAGCAGCAGCAACAACAGCAAAACAAGTCGCAACAGCAGCAACCGGGCCATGGCCAGCCCGCTGGCAACGTT
CCCGGTCCTGCTGGTCGCAGACTGCACATTGCCCATCGACGGAGCCCCTCGGAGCTGACCCCCCTGATGAGCATG
TTTGCCGCAAACCCAGGAAGTGAGTCTTTATTGCCACAGTTGTCCTTGTTCACTCCCGCCTTTGCACCACACTGG
TATCCTGGCCCGTGTTTTATTTTTCAGCTTCCCCATCACCTGCCTGATTGTCTTTGCCAGTCCCGCCCCATGGTT
CTGCTGCTGACGTCTTGTCCTCGTCCCAGTTGAACAGTTGGCAATTCAGCAACAGATCGAGCTTTTACAGCAGCA
GCAGCAGCAGCTCCAGGCTACCCATCAGCAATATGTCAACCTGGGCATGCTGCCCCCGGGCCAGCCCATGGCCCA
CAACGGCGCTTTCAATCCTTTGCAGCCCATGGCCAACATGCCTCAGAATGCTTTTCAATTCCCAAACCAGATTCC
TCAACAAAACATGGCCATGGCTCCCCCAACCCAGCCACTCTCTCATCGCCGTAATCAATCAGCCCTACCCAATAT
GGGCATGGGCATGGGCGGCCCACCCCCTGCACCTTCCTCCGGCGCCTCGGGTTCCAATTTTGGCAACTTTGAGGC
TCCCGGTGCCCATGGCAGAGAAAATACTGGCGGCCGAGGCGGCCGAGGCGGAGGCGGAGCCTCGAGTCACCAGCG
AAGACATTCTTTGGCTCTTGCCGATGCCAAAAAGGCTGCCGAGATCGCTCAGCAAAAGCGTACCACTACCGGATT
CCAATTCCCCGGTCCTGCTGCCTCGTCTGGCAAAATCGACGACGAGAATAGCAAAATGGCCGCCACTCATTCCAA
CCTTGACGCCTCTGTCGCCCACGGCTCAACCCGTGGCCGCGGAGGACATGGCCGCAGTCAGAGTATGGCTACCAA
TGGTCGTGGAGGCACTCGCATCGCCCCCGATGCTGGCGGCGACTTTCACCGACGCGGCGGCGGCGGCGGCGGCGG
TCATGCCCGTACTGGATCCCGGAGTTTTGAGGGCAATTGGCGCACTCAAAATCAGAATCAAGACCAGTCTGGCAA
TGTGAACCAGGCTTTTCAGCCCGGCCATCGGCCTCGAGGCTCAGTGAGCCAATCCGTTTCATCCATTGGAGCCTT
TCAATACAACCCAAGCCAGCCTCAACTCATGCAAATCCCAGGCCAAATTGTGATGCCACAGATGTTTGGCCAGCA
GCTCAATGCTATGCAGATGAATCAGTTGCAGGCTCTCCAGGCGGCTCAGATGAATGGACAGCAGTTTCAAGGTCT
GCAGAACTCTCAGCATGCGGGACCAATGGGGAACCAACAGCAACAACAGCAACAACAGCAGCGCAAGACGCTCTT
CACGCCATATTTGCCCCAGGCCTCCCTCCCTGCCCTATTGGGAGATGGCCAACTTGTCTCTGGTATCCTCCGTGT
CAACAAGAAGAATCGCAGCGACGCCTATGTCACTACGCAAGACGGTCTTCTTGATGCCGACATCTTTATTTGCGG
TAGCAAGGACCGCAACCGAGCCCTCGAGGGCGACCTGGTGGCTGTCGAACTCCTTGATGTTGATGAGGTTTGGTC
TCAGAAGCGAGAGAAGGAGGAAAAGAAGAAGCGAAAGGACATCACGGACACTCGTTCTGGTTCAACAAGTCAAGG
CAATCACAATTCTGGTCAGAATGACGATGGAAACACTGCTGAGGGTGGCATACGCCGCCGAGGTAGTCTGCGTCA
GCGTCCGACCCAAAAGAAAAACGACGACGTTGAAGTTGAAGGCCAGAGTCTTCTTTTGGTGGAAGAAGAAGAAAT
CAATGATGAGCAGAAGCCTCTGTACGCTGGCCACATTGTCGCGGTTATTGAGCGCGTGGCTGGACAAATGTTTTC
GGGAACCCTGGGACTGTTACGGCCTAGCAGCCAGGCTACCAAGGAGAAACAGGAGGCTGAAAGAGCTGCCAGAGA
TGGTGGCAACAGTCGTCACAATGACACTCGACAGCCAGAGAAGCCAAAGATTGTATGGTTCAAGCCAACGGACAA
GCGAGTCCCCTTGATTGCTATTCCGACGGAGCAAGCTCCTCGCGACTTTGTCGACAAGCACCAGGACTATGCTGA
TCGCATTTTTGTGGCCTGCATCAAGCGATGGCCAATCACGTCACTACATCCCTTTGGCACTTTAGTGGAACAGCT
GGGCCGCATGGGTGACCTTAAGGTGGAAACCGATGCCCTGCTACGAGACAACAACTTTTCGTCTGATGAATTTTC
GGATGCTGTGCTTCGAAGCGTTGGCTTCCAGGACTGGACCTTGGCCAATGAAGACGAGACGTCGATAGAATCTCG
CCGTGATTTCCGCGAGGAACAAGTCTTTACAGTCGACTTCAATGGCAGCGTCGAACTGGGTAATGCTGTTCATAT
CAAGACTGGTCCCGACGGCAAGATTGAAGTTGGTATCCATGTTCCTGACGTTGCACATTTTGTGAAGCCAAACTC
TCTTGTCGACAGAGAGGCCAAGAAGCGTGGTACGTCGGTGCAGCTACTCAACCGGTTCTGTGCCTTGCTTCCGCC
CAAGCTGTCTGGTGAGCTTTGTTCTCTGCTGCCTCAAGAGGATCGCTTGACAGTCAGCGTTGTATTCAATGTGAA
TCCTCACACTGGCGCCGTGGCCGAGGGTGATGGCTGGGTTGGACGCAGCATCATCAAGAGCGCAGGCAAACTGTC
ACTCAAAGACATTGACAGGGCGCTTGGTGATCCGACAACCTTTTCGAGCGGAGCGGCCACGAGCAAGACTATTCA
GATTCTGCAAGGGGTGGCCCAAAAGTTTCGAGAGGCGCGTCTTGGCGCTGGCGGTGAACCGATTGCACCGCTACG
TCTCTTTCGCCAACTCGACGACGAGAACAACCCTGTACAGGAAAATATATTTGACTCGACGCCCGCGCTGGAGCT
GGTTGAGGAGCTTATGCAAAAGGCAAACGCCTATGTAGCGCAGCGCCTCGCAGAGGGTCTTCCCGAAAAGGCCCT
TCTTCGCCGCCAGGCCTCTCCCAATCCCCGTCGCCTTCAGACATTTGTCGAGCGCATGACGGCTCTTGGCTACGA
TGTGGACGCGTCGGGAAGCGGAGCTCTCCAGAACAGCTTGTTCAAGATTGATGACGCGGAGCTTCGCAAGGGCAT
GGAAACACTGGTGCTCAAGTCGATGCACCGAGCCAAGTACTTCATTGCAGGCAAGACTGCCAAGCCATTGTGGCC
GCACTACTGCCTCAATCTGCCGCTTTACACACATTTCACGAGCCCGACGCGTCGCTACGCGGACATCTTGGTTCA
CCGACAGCTCGAGGCTGCTTTATCAGGGGGCAAGATTGAATTTACAGATGACATGGAAAGCCTGGTCAAGACTGT
CGAGTCGTGCAACACCAAGAAGGACTCGGCCCAAAATGCACAGGAACAGAGCATTCACATCGAGTCGTGTCGCAC
AATGGACAAGAAGCGGCAAGAGGTCAATGGTGACCTGATATCCGAAGGTGTCGTGCTGTGTGTTTACGAGTCAGC
CTTTGATGTGCTGATCCCAGAGTGGGGGTTTGAGAAGCGGGTGCACTGCGACCAGCTCCCACTCAAGAAGGCTGA
ATTTAGAAAGGAGAAGCGAGTGCTCGAGCTGTACTGGGAGAAGGGAGTGCCAAGCTCTGCGTACGTGCCCGAGGA
CGAGCGGCCAAAGGCAGCATCATCACAGCGGGTTTCCAATGCCATGGCTGCGGCACGGCAGGCAGAAGAGGCGGA
AAAGGCCAAGAAGGAGCGAGAAGAGGCGGCCCGCAAGCAGACTGAAACTGGCACCATGTCGACGGACGATGTCGA
GGCACTCTTTGACGATGAGGAGGACAACATGTCGGACGTGACTGAGGCCATGGCTGGAGTGTCGCTGGCGGAGCG
GCCGACGCAGAGCGTGCCCGGATCGCCGGCGCGCACATCTTCGAATGCTGGCACGCTACATCGAACCCGGTCTGA
CTCCAAGGTGCCAATCTCGGAGACGGTTGAGGGACGCCTCACCAACAAGGAACGATACCTTGATCTGTTCAAGTT
GCGGGAAGAGGGCGGCGACTACATCCAGGATGTGACGGAGATGACGAGGCTCCCCATCATTTTGAAGACGGACCT
CAGCAAGAGCCCGCCGTAAGTGTCATGCCATTTTGTTTATGGAGGGTGCATTGAAGAAGACGAAGCAAACAAAAA
CAAAAACTGACGAGGTGCAAACAGATGTCTGACCATCCGTTCCCTGAATCCGTATGCCCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail