Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4772
Gene name
LocationContig_41:936..2416
Strand-
Gene length (bp)1480
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 1.9E-123 32 365
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 2.3E-25 33 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74802|HIBCH_SCHPO 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehd3 PE=3 SV=1 21 355 2.0E-86
sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 18 363 3.0E-85
sp|Q58EB4|HIBCH_DANRE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 22 363 3.0E-83
sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 3 373 4.0E-82
sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 18 373 2.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74802|HIBCH_SCHPO 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehd3 PE=3 SV=1 21 355 2.0E-86
sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 18 363 3.0E-85
sp|Q58EB4|HIBCH_DANRE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 22 363 3.0E-83
sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 3 373 4.0E-82
sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 18 373 2.0E-81
sp|Q8QZS1|HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 3 381 1.0E-80
sp|Q28FR6|HIBCH_XENTR 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus tropicalis GN=hibch PE=2 SV=1 34 363 2.0E-79
sp|A2VDC2|HIBCH_XENLA 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 34 363 2.0E-78
sp|Q9LKJ1|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 22 382 5.0E-78
sp|P28817|HIBCH_YEAST 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHD3 PE=1 SV=2 23 456 1.0E-75
sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 23 363 4.0E-74
sp|Q55GS6|HIBCH_DICDI 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Dictyostelium discoideum GN=hibch PE=3 SV=1 21 360 1.0E-69
sp|Q2HJ73|HIBCH_BOVIN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Bos taurus GN=HIBCH PE=2 SV=1 18 381 2.0E-68
sp|Q1PEY5|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 22 363 3.0E-66
sp|Q8RXN4|HIBC5_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 18 374 3.0E-62
sp|Q9SHJ8|HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana GN=At1g06550 PE=1 SV=2 23 389 3.0E-60
sp|Q5XF59|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=At3g60510 PE=2 SV=1 10 384 4.0E-57
sp|Q9T0K7|HIBC6_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial OS=Arabidopsis thaliana GN=At4g13360 PE=1 SV=2 30 366 2.0E-44
sp|Q9LK08|HIBC7_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=At3g24360 PE=2 SV=1 30 360 5.0E-42
sp|O34893|YNGF_BACSU Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1 21 248 2.0E-21
sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 34 218 2.0E-21
sp|Q3TLP5|ECHD2_MOUSE Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 30 204 6.0E-19
sp|P52046|CRT_CLOAB Short-chain-enoyl-CoA hydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=1 SV=1 21 282 1.0E-18
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 30 204 3.0E-18
sp|Q86YB7|ECHD2_HUMAN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=1 SV=2 30 204 4.0E-18
sp|Q52995|ECHH_RHIME Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 34 248 3.0E-16
sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4 34 224 3.0E-15
sp|Q9LCU3|CBAD2_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-2 OS=Arthrobacter sp. GN=fcbB2 PE=1 SV=1 30 219 3.0E-15
sp|Q5R646|ECHM_PONAB Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1 34 224 6.0E-15
sp|Q8GB17|CAID_PROSL Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3 27 218 7.0E-15
sp|B4EY26|CAID_PROMH Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1 27 218 7.0E-15
sp|O85078|CBAD1_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-1 OS=Arthrobacter sp. GN=fcbB1 PE=1 SV=2 30 219 1.0E-14
sp|Q58DM8|ECHM_BOVIN Enoyl-CoA hydratase, mitochondrial OS=Bos taurus GN=ECHS1 PE=2 SV=1 34 224 2.0E-14
sp|P14604|ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1 34 218 6.0E-14
sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 34 224 2.0E-13
sp|Q1ZXF1|ECHM_DICDI Probable enoyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=echs1 PE=3 SV=1 34 218 2.0E-13
sp|P9WNN9|ECHA8_MYCTU Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA8 PE=1 SV=1 26 176 9.0E-12
sp|P9WNN8|ECHA8_MYCTO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA8 PE=3 SV=1 26 176 9.0E-12
sp|P64017|ECHA8_MYCBO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA8 PE=3 SV=1 26 176 9.0E-12
sp|B5BL54|CAID_SALPK Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiD PE=3 SV=1 34 218 9.0E-12
sp|C0Q4L2|CAID_SALPC Carnitinyl-CoA dehydratase OS=Salmonella paratyphi C (strain RKS4594) GN=caiD PE=3 SV=1 34 218 9.0E-12
sp|Q5PIL1|CAID_SALPA Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiD PE=3 SV=1 34 218 9.0E-12
sp|Q57TJ1|CAID_SALCH Carnitinyl-CoA dehydratase OS=Salmonella choleraesuis (strain SC-B67) GN=caiD PE=3 SV=1 34 218 9.0E-12
sp|B5F749|CAID_SALA4 Carnitinyl-CoA dehydratase OS=Salmonella agona (strain SL483) GN=caiD PE=3 SV=1 34 218 9.0E-12
sp|P76082|PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) GN=paaF PE=1 SV=1 34 201 1.0E-11
sp|P0ABU0|MENB_ECOLI 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli (strain K12) GN=menB PE=1 SV=1 26 176 1.0E-11
sp|P0ABU1|MENB_ECOL6 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=menB PE=3 SV=1 26 176 1.0E-11
sp|O07137|ECHA8_MYCLE Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 19 281 1.0E-11
sp|A9MYJ5|CAID_SALPB Carnitinyl-CoA dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiD PE=3 SV=1 34 218 1.0E-11
sp|B5RGA4|CAID_SALG2 Carnitinyl-CoA dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiD PE=3 SV=1 34 218 1.0E-11
sp|B5R1Q9|CAID_SALEP Carnitinyl-CoA dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiD PE=3 SV=1 34 218 1.0E-11
sp|B5FHG4|CAID_SALDC Carnitinyl-CoA dehydratase OS=Salmonella dublin (strain CT_02021853) GN=caiD PE=3 SV=1 34 218 1.0E-11
sp|Q7CQ56|MENB_SALTY 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menB PE=1 SV=1 26 176 2.0E-11
sp|P77467|PAAG_ECOLI 1,2-epoxyphenylacetyl-CoA isomerase OS=Escherichia coli (strain K12) GN=paaG PE=1 SV=1 30 217 2.0E-11
sp|A9MR28|CAID_SALAR Carnitinyl-CoA dehydratase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiD PE=3 SV=1 34 217 2.0E-11
sp|P94549|FADB_BACSU Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 43 184 2.0E-11
sp|P31551|CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) GN=caiD PE=1 SV=4 34 218 2.0E-11
sp|B1IRE0|CAID_ECOLC Carnitinyl-CoA dehydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiD PE=3 SV=1 34 218 2.0E-11
sp|Q8XA35|CAID_ECO57 Carnitinyl-CoA dehydratase OS=Escherichia coli O157:H7 GN=caiD PE=3 SV=3 34 218 2.0E-11
sp|P59395|CAID_SHIFL Carnitinyl-CoA dehydratase OS=Shigella flexneri GN=caiD PE=3 SV=2 34 218 2.0E-11
sp|P23966|MENB_BACSU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) GN=menB PE=1 SV=2 21 177 2.0E-11
sp|Q8FLA6|CAID_ECOL6 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiD PE=3 SV=3 34 218 3.0E-11
sp|Q0TLV3|CAID_ECOL5 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiD PE=3 SV=1 34 218 3.0E-11
sp|B1LFW9|CAID_ECOSM Carnitinyl-CoA dehydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiD PE=3 SV=1 34 218 3.0E-11
sp|Q8Z9L5|CAID_SALTI Carnitinyl-CoA dehydratase OS=Salmonella typhi GN=caiD PE=3 SV=3 34 218 4.0E-11
sp|Q8ZRX5|CAID_SALTY Carnitinyl-CoA dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiD PE=3 SV=3 34 218 6.0E-11
sp|B4TWR3|CAID_SALSV Carnitinyl-CoA dehydratase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiD PE=3 SV=1 34 218 6.0E-11
sp|B4TIG9|CAID_SALHS Carnitinyl-CoA dehydratase OS=Salmonella heidelberg (strain SL476) GN=caiD PE=3 SV=1 34 218 6.0E-11
sp|P41942|YKB4_CAEEL Uncharacterized protein B0272.4 OS=Caenorhabditis elegans GN=B0272.4 PE=3 SV=1 34 209 6.0E-11
sp|B4T6J5|CAID_SALNS Carnitinyl-CoA dehydratase OS=Salmonella newport (strain SL254) GN=caiD PE=3 SV=1 34 218 7.0E-11
sp|Q96DC8|ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens GN=ECHDC3 PE=1 SV=2 30 217 8.0E-11
sp|A8ALR7|CAID_CITK8 Carnitinyl-CoA dehydratase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiD PE=3 SV=1 27 218 9.0E-11
sp|Q39TV7|BAMA_GEOMG 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=bamA PE=1 SV=1 34 192 1.0E-10
sp|P53526|ECH12_MYCLE Probable enoyl-CoA hydratase echA12 OS=Mycobacterium leprae (strain TN) GN=echA12 PE=3 SV=1 7 176 3.0E-10
sp|Q9D9V3|ECHD1_MOUSE Ethylmalonyl-CoA decarboxylase OS=Mus musculus GN=Echdc1 PE=1 SV=2 12 176 4.0E-10
sp|O35459|ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus GN=Ech1 PE=1 SV=1 34 176 4.0E-10
sp|Q8DSN0|FABM_STRMU Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fabM PE=3 SV=1 22 216 5.0E-10
sp|Q7N288|FADJ_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadJ PE=3 SV=2 34 212 6.0E-10
sp|Q5RFG0|ECH1_PONAB Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Pongo abelii GN=ECH1 PE=2 SV=1 11 216 6.0E-10
sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=ECH1 PE=1 SV=2 11 216 8.0E-10
sp|P44960|MENB_HAEIN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menB PE=3 SV=1 30 176 8.0E-10
sp|Q8FFG4|FADJ_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 34 238 9.0E-10
sp|Q9CLV5|MENB_PASMU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Pasteurella multocida (strain Pm70) GN=menB PE=3 SV=1 30 176 1.0E-09
sp|B5FPN1|FADJ_SALDC Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|B4TQC2|FADJ_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|B4SZR0|FADJ_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|B4TCA8|FADJ_SALHS Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|B5R3R9|FADJ_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|B5EZR9|FADJ_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|Q8ZNA7|FADJ_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|Q57LW6|FADJ_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|B5RCL3|FADJ_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|A9N453|FADJ_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|Q62651|ECH1_RAT Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus GN=Ech1 PE=1 SV=2 36 176 1.0E-09
sp|Q8Z4Z0|FADJ_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 34 238 1.0E-09
sp|P34559|ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=3 SV=1 34 248 2.0E-09
sp|Q54HG7|AUHM_DICDI Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1 30 176 2.0E-09
sp|Q5LLW6|DMDD_RUEPO Methylthioacryloyl-CoA hydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdD PE=1 SV=1 30 176 3.0E-09
sp|B7M6M2|FADJ_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 34 238 3.0E-09
sp|Q9TM10|MENB_CYACA 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Cyanidium caldarium GN=menB PE=3 SV=1 34 176 3.0E-09
sp|A7ZPF8|FADJ_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 34 238 3.0E-09
sp|B7LBJ5|FADJ_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 34 238 3.0E-09
sp|Q5HQC3|MENB_STAEQ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menB PE=3 SV=1 5 177 3.0E-09
sp|Q869N6|CRTL_DICDI 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0271866 PE=3 SV=1 30 278 3.0E-09
sp|Q8CPQ4|MENB_STAES 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menB PE=3 SV=1 21 177 3.0E-09
sp|A1JIG4|FADB_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadB PE=3 SV=1 30 176 3.0E-09
sp|B6I6Q4|FADJ_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 34 238 3.0E-09
sp|Q4L549|MENB_STAHJ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menB PE=3 SV=1 5 177 4.0E-09
sp|B7NP24|FADJ_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 34 238 6.0E-09
sp|B7N5V2|FADJ_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 34 238 6.0E-09
sp|Q49WG8|MENB_STAS1 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menB PE=3 SV=1 30 177 6.0E-09
sp|A5JTM5|CBADH_PSEUC 4-chlorobenzoyl coenzyme A dehalogenase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 30 176 7.0E-09
sp|Q8XCP2|FADJ_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 34 238 8.0E-09
sp|B5YXY4|FADJ_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 34 238 8.0E-09
sp|B5BBA1|FADJ_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadJ PE=3 SV=1 34 238 8.0E-09
sp|Q5PCX6|FADJ_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadJ PE=3 SV=1 34 238 8.0E-09
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 29 176 8.0E-09
sp|B2TWV4|FADJ_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 41 238 9.0E-09
sp|Q31YB7|FADJ_SHIBS Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 4 (strain Sb227) GN=fadJ PE=3 SV=1 41 238 1.0E-08
sp|B1LME7|FADJ_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 34 238 1.0E-08
sp|Q0T2E6|FADJ_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 41 238 1.0E-08
sp|Q3MIE0|ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus GN=Echdc3 PE=2 SV=1 16 227 1.0E-08
sp|Q8NXA0|MENB_STAAW 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MW2) GN=menB PE=3 SV=1 21 177 1.0E-08
sp|Q6GAG7|MENB_STAAS 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MSSA476) GN=menB PE=3 SV=1 21 177 1.0E-08
sp|Q7A6A9|MENB_STAAN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain N315) GN=menB PE=1 SV=1 21 177 2.0E-08
sp|Q99V48|MENB_STAAM 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menB PE=3 SV=1 21 177 2.0E-08
sp|Q6GI37|MENB_STAAR 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MRSA252) GN=menB PE=3 SV=1 21 177 2.0E-08
sp|Q5HH38|MENB_STAAC 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain COL) GN=menB PE=1 SV=1 21 177 2.0E-08
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 34 176 2.0E-08
sp|Q3YZM2|FADJ_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 41 238 2.0E-08
sp|Q83QQ0|FADJ_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 41 238 2.0E-08
sp|A9JS71|ECHD3_XENLA Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Xenopus laevis GN=echdc3 PE=2 SV=1 24 173 2.0E-08
sp|A4WCW6|FADJ_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1 34 238 2.0E-08
sp|Q0TFA6|FADJ_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1 34 238 2.0E-08
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 41 238 2.0E-08
sp|P77399|FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1 34 238 2.0E-08
sp|B1X9L4|FADJ_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1 34 238 2.0E-08
sp|C4ZVN2|FADJ_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadJ PE=3 SV=1 34 238 2.0E-08
sp|B7MY16|FADJ_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1 34 238 2.0E-08
sp|A6V382|FADB_PSEA7 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 41 176 3.0E-08
sp|Q6NYL3|ECHP_DANRE Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 34 188 3.0E-08
sp|Q6AYG5|ECHD1_RAT Ethylmalonyl-CoA decarboxylase OS=Rattus norvegicus GN=Echdc1 PE=1 SV=1 12 184 3.0E-08
sp|Q9D7J9|ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus GN=Echdc3 PE=1 SV=1 30 173 4.0E-08
sp|B7UFZ8|FADJ_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1 34 238 4.0E-08
sp|O87872|BAMA_THAAR 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Thauera aromatica GN=oah PE=1 SV=1 34 192 4.0E-08
sp|Q1R972|FADJ_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1 34 238 4.0E-08
sp|A1ADI8|FADJ_ECOK1 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1 34 238 4.0E-08
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 29 176 4.0E-08
sp|O69762|HCHL_PSEFL Hydroxycinnamoyl-CoA hydratase-lyase OS=Pseudomonas fluorescens PE=1 SV=1 30 163 4.0E-08
sp|P9WNP1|ECHA6_MYCTU Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA6 PE=1 SV=1 33 219 4.0E-08
sp|P9WNP0|ECHA6_MYCTO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA6 PE=3 SV=1 33 219 4.0E-08
sp|P64015|ECHA6_MYCBO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA6 PE=3 SV=1 33 219 4.0E-08
sp|Q50130|ECHA6_MYCLE Probable enoyl-CoA hydratase echA6 OS=Mycobacterium leprae (strain TN) GN=echA6 PE=3 SV=1 30 201 4.0E-08
sp|B7MGV7|FADJ_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1 34 238 4.0E-08
sp|Q7MZ92|FADB_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 30 176 4.0E-08
sp|A0PJR5|ECHD3_DANRE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Danio rerio GN=echdc3 PE=2 SV=2 1 211 4.0E-08
sp|P28793|FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 41 176 5.0E-08
sp|Q32DJ4|FADJ_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 34 238 5.0E-08
sp|B1IXA5|FADJ_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 41 238 5.0E-08
sp|Q5R5M8|ECHP_PONAB Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 43 188 5.0E-08
sp|Q29554|ECHA_PIG Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 29 176 5.0E-08
sp|A8G8D1|FADB_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadB PE=3 SV=1 30 176 6.0E-08
sp|Q9HZJ2|FADB_PSEAE Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 41 176 6.0E-08
sp|Q02PH8|FADB_PSEAB Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 41 176 6.0E-08
sp|B7UYR6|FADB_PSEA8 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 41 176 6.0E-08
sp|Q87MM3|FADJ_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadJ PE=3 SV=1 41 212 7.0E-08
sp|Q3K9D8|FADB_PSEPF Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadB PE=3 SV=1 41 176 8.0E-08
sp|A7MH81|FADJ_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadJ PE=3 SV=1 19 218 8.0E-08
sp|A8ADP2|FADJ_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1 34 238 9.0E-08
sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 35 199 1.0E-07
sp|C3K613|FADB_PSEFS Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=fadB PE=3 SV=1 41 176 1.0E-07
sp|Q8DR19|FABM_STRR6 Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fabM PE=1 SV=1 21 226 1.0E-07
sp|A7MS61|FADJ_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1 41 212 1.0E-07
sp|Q8GYN9|MENB_ARATH 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana GN=MENB PE=1 SV=2 22 176 1.0E-07
sp|Q9XB60|CARB_PECCC Carboxymethylproline synthase OS=Pectobacterium carotovorum subsp. carotovorum GN=carB PE=1 SV=1 32 170 1.0E-07
sp|B6EGU2|FADB_ALISL Fatty acid oxidation complex subunit alpha OS=Aliivibrio salmonicida (strain LFI1238) GN=fadB PE=3 SV=1 30 176 1.0E-07
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 43 188 1.0E-07
sp|Q9KT58|FADJ_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadJ PE=3 SV=2 25 220 2.0E-07
sp|A5F2P2|FADJ_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadJ PE=3 SV=1 25 220 2.0E-07
sp|Q1I7D4|FADB_PSEE4 Fatty acid oxidation complex subunit alpha OS=Pseudomonas entomophila (strain L48) GN=fadB PE=3 SV=1 41 176 2.0E-07
sp|Q6D2L7|FADJ_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 34 176 2.0E-07
sp|Q9AHY3|FADB_PSEPU Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida GN=fadB PE=3 SV=2 41 176 3.0E-07
sp|Q2LXU2|BAMA_SYNAS 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Syntrophus aciditrophicus (strain SB) GN=bamA PE=1 SV=1 34 172 3.0E-07
sp|Q66FR8|FADB_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|B2K0Z6|FADB_YERPB Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|A7FDF2|FADB_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|B1JP63|FADB_YERPY Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|A4TR27|FADB_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|Q1CN99|FADB_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|A9R754|FADB_YERPG Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|Q8ZAN0|FADB_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|Q1C2C4|FADB_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadB PE=3 SV=1 30 176 3.0E-07
sp|Q4KFC4|FADB_PSEF5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadB PE=3 SV=1 41 176 3.0E-07
sp|Q9Y232|CDYL1_HUMAN Chromodomain Y-like protein OS=Homo sapiens GN=CDYL PE=1 SV=2 22 219 3.0E-07
sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2 36 176 3.0E-07
sp|Q489W3|FADB_COLP3 Fatty acid oxidation complex subunit alpha OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadB PE=3 SV=1 70 177 4.0E-07
sp|B1J5A5|FADB_PSEPW Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain W619) GN=fadB PE=3 SV=1 41 176 5.0E-07
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 30 176 6.0E-07
sp|B0KH74|FADB_PSEPG Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 41 176 6.0E-07
sp|A5W6H0|FADB_PSEP1 Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadB PE=3 SV=1 41 176 9.0E-07
sp|A1JK30|FADJ_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadJ PE=3 SV=2 41 227 1.0E-06
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 23 240 1.0E-06
sp|Q93Q12|FADB_PSEOL Fatty acid oxidation complex subunit alpha OS=Pseudomonas oleovorans GN=fadB PE=3 SV=1 41 176 2.0E-06
sp|A1S1I8|FADB_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadB PE=3 SV=1 34 176 2.0E-06
sp|Q88L02|FADB_PSEPK Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain KT2440) GN=fadB PE=3 SV=1 41 176 2.0E-06
sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 41 176 2.0E-06
sp|A4STF2|FADB_AERS4 Fatty acid oxidation complex subunit alpha OS=Aeromonas salmonicida (strain A449) GN=fadB PE=3 SV=1 30 176 2.0E-06
sp|Q5E8X6|FADB_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadB PE=3 SV=1 30 176 3.0E-06
sp|B5FEW8|FADB_VIBFM Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain MJ11) GN=fadB PE=3 SV=1 30 176 3.0E-06
sp|Q6DAP5|FADB_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadB PE=3 SV=1 30 176 3.0E-06
sp|A4VKA3|FADB_PSEU5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=fadB PE=3 SV=1 41 176 4.0E-06
sp|Q87ZB2|FADB_PSESM Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 41 176 5.0E-06
sp|B5XYH0|FADB_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 30 176 5.0E-06
sp|Q6LW06|FADB_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|Q5QXH7|FADB_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|B5BIZ0|FADB_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|Q5PKQ2|FADB_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|Q9L6L5|FADB_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|B5EZW0|FADB_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|A7ZU51|FADB_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|A6TGM4|FADB_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|B4SZ85|FADB_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|B5RFL6|FADB_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|B5QW85|FADB_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadB PE=3 SV=1 30 176 6.0E-06
sp|Q8Z3C6|FADB_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadB PE=3 SV=1 30 176 7.0E-06
sp|A9MYB0|FADB_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadB PE=3 SV=1 30 176 7.0E-06
sp|Q57HM6|FADB_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadB PE=3 SV=2 30 176 7.0E-06
sp|Q4ZRA0|FADB_PSEU2 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 41 176 7.0E-06
sp|A0KEL1|FADB_AERHH Fatty acid oxidation complex subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadB PE=3 SV=1 30 176 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2265
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4772 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7762
Ophiocordyceps camponoti-floridani Ophcf2|06759
Ophiocordyceps camponoti-rufipedis Ophun1|4117
Ophiocordyceps kimflemingae Ophio5|3603
Ophiocordyceps subramaniannii Hirsu2|2957

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4772
MSRKISTEASSLRELPDDKPDDVVFDSRYGFRSIILNRPGKYNSLNASMIRKIVPRLVQWEKSDMANVIVIKGAG
QKAFCAGGDVVELARLNDKEGGWKKSAEYFALEYKLDHYIATYSKPLIAFMDGITMGGGVGLSIHAPFRIATERT
VFAMPETTIGFFPDVGATFFLPRLNGYVGTCLALTSDRLTGPNVFYAGIATHYIHSTTLPDLEARLAELKFSDSD
SLRTRLDIINNTLEEFATGLPFDIPMKMAGEVRRAIDRCYSRDSVSDIIAALEEEQKGDMAKWASEQLKMLKEKS
PTSLHVTLRQMRDGSKWDIAEVFQKEYQLANKFMKHPDFSEGVKARLVRKTPPIWKPDSLKNLPSNADLAGPFFE
FDNDLKIELFTPNTYSDYPYAALGVPTEKEIKELILTRAFTPRELVKALHDSRKGRQGIAEVVQEIVARMTIVDS
DGNVRWTEDEAAPDSKL*
Coding >OphauG2|4772
ATGTCGCGAAAGATATCAACAGAGGCCTCATCACTACGCGAGCTTCCTGACGACAAGCCCGACGACGTCGTCTTT
GACAGTCGCTATGGATTCCGGTCCATCATCCTCAACCGCCCCGGAAAGTACAACTCCCTCAATGCGTCCATGATT
CGCAAAATCGTTCCCCGCCTTGTACAGTGGGAAAAGTCGGACATGGCCAATGTCATTGTCATCAAGGGCGCGGGC
CAAAAAGCTTTTTGCGCAGGCGGCGACGTTGTGGAGCTGGCCCGTCTCAACGACAAGGAAGGCGGCTGGAAAAAG
TCGGCAGAGTACTTTGCCCTTGAATACAAGCTTGATCATTACATTGCCACCTACTCAAAGCCCTTGATTGCCTTC
ATGGATGGCATTACCATGGGCGGTGGCGTGGGACTCAGCATCCATGCTCCCTTCCGCATCGCCACCGAACGGACA
GTCTTTGCCATGCCCGAGACCACCATTGGATTCTTCCCCGACGTGGGCGCAACCTTTTTCCTTCCTCGATTAAAT
GGCTACGTTGGCACATGCTTGGCGCTGACTAGCGATCGTTTGACGGGCCCCAATGTCTTTTATGCTGGCATCGCA
ACGCATTACATCCATTCGACCACTTTGCCTGATCTCGAAGCCCGCCTAGCTGAACTCAAGTTTAGTGACAGCGAT
TCACTTCGTACCAGGCTCGACATTATTAACAACACACTGGAAGAGTTTGCCACAGGTCTGCCATTTGATATCCCT
ATGAAAATGGCGGGCGAGGTCCGTCGGGCAATTGACCGCTGCTACAGCCGAGACAGCGTCAGTGACATCATAGCG
GCTCTTGAGGAAGAGCAAAAGGGGGATATGGCAAAATGGGCCTCTGAACAGCTCAAGATGCTTAAAGAAAAGTCG
CCAACATCATTACACGTCACCCTGCGACAGATGCGGGACGGCAGCAAATGGGACATTGCCGAGGTTTTCCAGAAA
GAATATCAACTTGCCAACAAGTTTATGAAGCACCCAGACTTTAGCGAGGGTGTCAAGGCACGCCTTGTGCGAAAG
ACACCGCCTATATGGAAACCGGATTCGCTCAAGAATCTACCAAGCAACGCGGATCTGGCAGGGCCTTTTTTCGAA
TTTGACAACGACTTAAAGATTGAGCTCTTCACCCCCAACACGTACTCTGACTACCCCTATGCCGCACTCGGTGTA
CCCACCGAAAAGGAAATAAAAGAGCTAATTTTAACCCGCGCATTCACGCCTCGAGAGCTCGTCAAGGCGCTTCAC
GACTCTCGCAAGGGTCGGCAAGGTATTGCAGAGGTGGTGCAAGAAATCGTTGCCCGCATGACCATAGTCGACAGC
GATGGAAATGTAAGGTGGACAGAGGACGAGGCCGCTCCCGATAGCAAACTGTAG
Transcript >OphauG2|4772
ATGTCGCGAAAGATATCAACAGAGGCCTCATCACTACGCGAGCTTCCTGACGACAAGCCCGACGACGTCGTCTTT
GACAGTCGCTATGGATTCCGGTCCATCATCCTCAACCGCCCCGGAAAGTACAACTCCCTCAATGCGTCCATGATT
CGCAAAATCGTTCCCCGCCTTGTACAGTGGGAAAAGTCGGACATGGCCAATGTCATTGTCATCAAGGGCGCGGGC
CAAAAAGCTTTTTGCGCAGGCGGCGACGTTGTGGAGCTGGCCCGTCTCAACGACAAGGAAGGCGGCTGGAAAAAG
TCGGCAGAGTACTTTGCCCTTGAATACAAGCTTGATCATTACATTGCCACCTACTCAAAGCCCTTGATTGCCTTC
ATGGATGGCATTACCATGGGCGGTGGCGTGGGACTCAGCATCCATGCTCCCTTCCGCATCGCCACCGAACGGACA
GTCTTTGCCATGCCCGAGACCACCATTGGATTCTTCCCCGACGTGGGCGCAACCTTTTTCCTTCCTCGATTAAAT
GGCTACGTTGGCACATGCTTGGCGCTGACTAGCGATCGTTTGACGGGCCCCAATGTCTTTTATGCTGGCATCGCA
ACGCATTACATCCATTCGACCACTTTGCCTGATCTCGAAGCCCGCCTAGCTGAACTCAAGTTTAGTGACAGCGAT
TCACTTCGTACCAGGCTCGACATTATTAACAACACACTGGAAGAGTTTGCCACAGGTCTGCCATTTGATATCCCT
ATGAAAATGGCGGGCGAGGTCCGTCGGGCAATTGACCGCTGCTACAGCCGAGACAGCGTCAGTGACATCATAGCG
GCTCTTGAGGAAGAGCAAAAGGGGGATATGGCAAAATGGGCCTCTGAACAGCTCAAGATGCTTAAAGAAAAGTCG
CCAACATCATTACACGTCACCCTGCGACAGATGCGGGACGGCAGCAAATGGGACATTGCCGAGGTTTTCCAGAAA
GAATATCAACTTGCCAACAAGTTTATGAAGCACCCAGACTTTAGCGAGGGTGTCAAGGCACGCCTTGTGCGAAAG
ACACCGCCTATATGGAAACCGGATTCGCTCAAGAATCTACCAAGCAACGCGGATCTGGCAGGGCCTTTTTTCGAA
TTTGACAACGACTTAAAGATTGAGCTCTTCACCCCCAACACGTACTCTGACTACCCCTATGCCGCACTCGGTGTA
CCCACCGAAAAGGAAATAAAAGAGCTAATTTTAACCCGCGCATTCACGCCTCGAGAGCTCGTCAAGGCGCTTCAC
GACTCTCGCAAGGGTCGGCAAGGTATTGCAGAGGTGGTGCAAGAAATCGTTGCCCGCATGACCATAGTCGACAGC
GATGGAAATGTAAGGTGGACAGAGGACGAGGCCGCTCCCGATAGCAAACTGTAG
Gene >OphauG2|4772
ATGTCGCGAAAGGTAAGAAGAGTACTATTTATCTAATGTATCCATCGGGTTGCCGTGTCTGCGTCCTCACAGTGT
GTCATGATGATAGATATCAACAGAGGCCTCATCACTACGCGAGCTTCCTGACGACAAGCCCGACGACGTCGTCTT
TGACAGTCGCTATGGATTCCGGTCCATCATCCTCAACCGCCCCGGAAAGTACAACTCCCTCAATGCGTCCATGAT
TCGCAAAATCGTTCCCCGCCTTGTACAGTGGGAAAAGTCGGACATGGCCAATGTCATTGTCATCAAGGGCGCGGG
CCAAAAAGCTTTTTGCGCAGGCGGCGACGTTGTGGAGCTGGCCCGTCTCAACGACAAGGAAGGCGGCTGGAAAAA
GTCGGCAGAGTACTTTGCCCTTGAATACAAGCTTGATCATTACATTGCCACCTACTCAAAGCCCTTGATTGCCTT
CATGGATGGCATTACCATGGGCGGTGGCGTGGGACTCAGCATCCATGCTCCCTTCCGCATCGCCACCGAACGGAC
AGTCTTTGCCATGCCCGAGACCACCATTGGATTCTTCCCCGACGTGGGCGCAACCTTTTTCCTTCCTCGATTAAA
TGGCTACGTTGGCACATGCTTGGCGCTGACTAGCGATCGTTTGACGGGCCCCAATGTCTTTTATGCTGGCATCGC
AACGCATTACATCCATTCGACCACTTTGCCTGATCTCGAAGCCCGCCTAGCTGAACTCAAGTTTAGTGACAGCGA
TTCACTTCGTACCAGGCTCGACATTATTAACAACACACTGGAAGAGTTTGCCACAGGTCTGCCATTTGATATCCC
TATGAAAATGGCGGGCGAGGTCCGTCGGGCAATTGACCGCTGCTACAGCCGAGACAGCGTCAGTGACATCATAGC
GGCTCTTGAGGAAGAGCAAAAGGGGGATATGGCAAAATGGGCCTCTGAACAGCTCAAGATGCTTAAAGAAAAGTC
GCCAACATCATTACACGTCACCCTGCGACAGATGCGGGACGGCAGCAAATGGGACATTGCCGAGGTTTTCCAGAA
AGAATATCAACTTGCCAACAAGTTTATGAAGCACCCAGACTTTAGCGAGGGTGTCAAGGCACGCCTTGTGCGAAA
GACACCGCCTATATGGAAACCGGATTCGCTCAAGAATCTACCAAGCAACGCGGATCTGGCAGGGCCTTTTTTCGA
ATTTGACAACGACTTAAAGATTGAGCTCTTCACCCCCAACACGTACTCTGACTACCCCTATGCCGCACTCGGTGT
ACCCACCGAAAAGGAAATAAAAGAGCTAATTTTAACCCGCGCATTCACGCCTCGAGAGCTCGTCAAGGCGCTTCA
CGACTCTCGCAAGGGTCGGCAAGGTATTGCAGAGGTGGTGCAAGAAATCGTTGCCCGCATGACCATAGTCGACAG
CGATGGAAATGTAAGGTGGACAGAGGACGAGGCCGCTCCCGATAGCAAACTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail