Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4771
Gene name
LocationContig_409:14067..16115
Strand+
Gene length (bp)2048
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain 2.6E-18 539 608
PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain 2.6E-18 462 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33759|RT05_YEAST 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 459 620 5.0E-38
sp|Q10234|RT05_SCHPO Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 447 620 1.0E-36
sp|Q99N87|RT05_MOUSE 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 463 616 5.0E-21
sp|Q5REJ1|RT05_PONAB 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 478 616 1.0E-18
sp|P82675|RT05_HUMAN 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 463 616 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33759|RT05_YEAST 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 459 620 5.0E-38
sp|Q10234|RT05_SCHPO Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 447 620 1.0E-36
sp|Q99N87|RT05_MOUSE 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 463 616 5.0E-21
sp|Q5REJ1|RT05_PONAB 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 478 616 1.0E-18
sp|P82675|RT05_HUMAN 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 463 616 2.0E-18
sp|Q2KID9|RT05_BOVIN 28S ribosomal protein S5, mitochondrial OS=Bos taurus GN=MRPS5 PE=1 SV=1 463 617 9.0E-17
sp|P57574|RS5_BUCAI 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsE PE=3 SV=1 450 615 5.0E-13
sp|Q93425|RT05_CAEEL Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis elegans GN=mrps-5 PE=3 SV=3 453 615 4.0E-12
sp|A8Y3Q1|RT05_CAEBR Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis briggsae GN=mrps-5 PE=3 SV=3 453 615 7.0E-12
sp|Q8K966|RS5_BUCAP 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsE PE=3 SV=1 450 615 1.0E-11
sp|A1KRJ0|RS5_NEIMF 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsE PE=3 SV=1 461 621 7.0E-11
sp|P66577|RS5_NEIMB 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsE PE=3 SV=1 461 621 7.0E-11
sp|P66576|RS5_NEIMA 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsE PE=3 SV=1 461 621 7.0E-11
sp|A9M3U9|RS5_NEIM0 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsE PE=3 SV=1 461 621 7.0E-11
sp|Q5F5U4|RS5_NEIG1 30S ribosomal protein S5 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsE PE=3 SV=1 461 621 7.0E-11
sp|A0KF38|RS5_AERHH 30S ribosomal protein S5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsE PE=3 SV=1 461 615 2.0E-10
sp|C4L7U7|RS5_TOLAT 30S ribosomal protein S5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsE PE=3 SV=1 461 615 2.0E-10
sp|A4SSY9|RS5_AERS4 30S ribosomal protein S5 OS=Aeromonas salmonicida (strain A449) GN=rpsE PE=3 SV=1 461 615 4.0E-10
sp|Q7VQD1|RS5_BLOFL 30S ribosomal protein S5 OS=Blochmannia floridanus GN=rpsE PE=3 SV=1 451 612 4.0E-10
sp|Q83EQ9|RS5_COXBU 30S ribosomal protein S5 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsE PE=3 SV=1 464 615 4.0E-10
sp|A1W325|RS5_ACISJ 30S ribosomal protein S5 OS=Acidovorax sp. (strain JS42) GN=rpsE PE=3 SV=1 461 615 8.0E-10
sp|B9MBV4|RS5_ACIET 30S ribosomal protein S5 OS=Acidovorax ebreus (strain TPSY) GN=rpsE PE=3 SV=1 461 615 8.0E-10
sp|Q493J1|RS5_BLOPB 30S ribosomal protein S5 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsE PE=3 SV=1 461 619 9.0E-10
sp|A1A086|RS5_BIFAA 30S ribosomal protein S5 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpsE PE=3 SV=1 461 615 9.0E-10
sp|Q89A82|RS5_BUCBP 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsE PE=3 SV=2 461 620 1.0E-09
sp|Q4FLN5|RS5_PELUB 30S ribosomal protein S5 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsE PE=3 SV=1 453 615 1.0E-09
sp|Q1LTC1|RS5_BAUCH 30S ribosomal protein S5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsE PE=3 SV=1 456 615 1.0E-09
sp|Q6CZY7|RS5_PECAS 30S ribosomal protein S5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsE PE=3 SV=1 456 615 1.0E-09
sp|Q7VKF0|RS5_HAEDU 30S ribosomal protein S5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsE PE=3 SV=1 456 615 1.0E-09
sp|Q8D1Z5|RS5_WIGBR 30S ribosomal protein S5 OS=Wigglesworthia glossinidia brevipalpis GN=rpsE PE=3 SV=1 456 615 2.0E-09
sp|Q057C1|RS5_BUCCC 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsE PE=3 SV=1 461 610 2.0E-09
sp|Q7MPH1|RS5_VIBVY 30S ribosomal protein S5 OS=Vibrio vulnificus (strain YJ016) GN=rpsE PE=3 SV=1 461 609 4.0E-09
sp|Q8DE57|RS5_VIBVU 30S ribosomal protein S5 OS=Vibrio vulnificus (strain CMCP6) GN=rpsE PE=3 SV=1 461 609 4.0E-09
sp|B7GNC3|RS5_BIFLS 30S ribosomal protein S5 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpsE PE=3 SV=1 461 615 4.0E-09
sp|B3DQD1|RS5_BIFLD 30S ribosomal protein S5 OS=Bifidobacterium longum (strain DJO10A) GN=rpsE PE=3 SV=1 461 615 4.0E-09
sp|Q32B48|RS5_SHIDS 30S ribosomal protein S5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsE PE=3 SV=1 456 615 4.0E-09
sp|Q87SZ6|RS5_VIBPA 30S ribosomal protein S5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsE PE=3 SV=1 461 609 5.0E-09
sp|A7MWH5|RS5_VIBCB 30S ribosomal protein S5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsE PE=3 SV=1 461 609 5.0E-09
sp|Q3YWV6|RS5_SHISS 30S ribosomal protein S5 OS=Shigella sonnei (strain Ss046) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|P0A7W6|RS5_SHIFL 30S ribosomal protein S5 OS=Shigella flexneri GN=rpsE PE=3 SV=2 456 615 5.0E-09
sp|Q0SZZ9|RS5_SHIF8 30S ribosomal protein S5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|Q31VX3|RS5_SHIBS 30S ribosomal protein S5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|P0A7W4|RS5_SALTY 30S ribosomal protein S5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsE PE=1 SV=2 456 615 5.0E-09
sp|P0A7W5|RS5_SALTI 30S ribosomal protein S5 OS=Salmonella typhi GN=rpsE PE=3 SV=2 456 615 5.0E-09
sp|A9MSY1|RS5_SALPB 30S ribosomal protein S5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|Q5PK01|RS5_SALPA 30S ribosomal protein S5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|Q57J49|RS5_SALCH 30S ribosomal protein S5 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|A9MN66|RS5_SALAR 30S ribosomal protein S5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|Q1R627|RS5_ECOUT 30S ribosomal protein S5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|P0A7W1|RS5_ECOLI 30S ribosomal protein S5 OS=Escherichia coli (strain K12) GN=rpsE PE=1 SV=2 456 615 5.0E-09
sp|B1IPZ6|RS5_ECOLC 30S ribosomal protein S5 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|P0A7W2|RS5_ECOL6 30S ribosomal protein S5 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsE PE=3 SV=2 456 615 5.0E-09
sp|Q0TCF8|RS5_ECOL5 30S ribosomal protein S5 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|A1AGJ2|RS5_ECOK1 30S ribosomal protein S5 OS=Escherichia coli O1:K1 / APEC GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|A8A5A8|RS5_ECOHS 30S ribosomal protein S5 OS=Escherichia coli O9:H4 (strain HS) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|P0A7W3|RS5_ECO57 30S ribosomal protein S5 OS=Escherichia coli O157:H7 GN=rpsE PE=3 SV=2 456 615 5.0E-09
sp|A7ZSJ2|RS5_ECO24 30S ribosomal protein S5 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|A8AQJ8|RS5_CITK8 30S ribosomal protein S5 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsE PE=3 SV=1 456 615 5.0E-09
sp|A1TJT4|RS5_ACIAC 30S ribosomal protein S5 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsE PE=3 SV=1 464 615 6.0E-09
sp|B7VLE0|RS5_VIBTL 30S ribosomal protein S5 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsE PE=3 SV=1 461 609 6.0E-09
sp|P59122|RS5_BIFLO 30S ribosomal protein S5 OS=Bifidobacterium longum (strain NCC 2705) GN=rpsE PE=3 SV=1 461 615 6.0E-09
sp|A1RWR6|RS5_THEPD 30S ribosomal protein S5 OS=Thermofilum pendens (strain Hrk 5) GN=rps5 PE=3 SV=1 438 597 6.0E-09
sp|A0M581|RS5_GRAFK 30S ribosomal protein S5 OS=Gramella forsetii (strain KT0803) GN=rpsE PE=3 SV=1 442 621 6.0E-09
sp|A7MPG7|RS5_CROS8 30S ribosomal protein S5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsE PE=3 SV=1 456 615 7.0E-09
sp|Q2NQN9|RS5_SODGM 30S ribosomal protein S5 OS=Sodalis glossinidius (strain morsitans) GN=rpsE PE=3 SV=1 456 615 7.0E-09
sp|A1WK99|RS5_VEREI 30S ribosomal protein S5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsE PE=3 SV=1 461 615 8.0E-09
sp|Q6NJ85|RS5_CORDI 30S ribosomal protein S5 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rpsE PE=3 SV=1 456 615 1.0E-08
sp|A1S235|RS5_SHEAM 30S ribosomal protein S5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsE PE=3 SV=1 461 616 1.0E-08
sp|A9KWB9|RS5_SHEB9 30S ribosomal protein S5 OS=Shewanella baltica (strain OS195) GN=rpsE PE=3 SV=1 461 616 1.0E-08
sp|A6WHU5|RS5_SHEB8 30S ribosomal protein S5 OS=Shewanella baltica (strain OS185) GN=rpsE PE=3 SV=1 461 616 1.0E-08
sp|A3DA55|RS5_SHEB5 30S ribosomal protein S5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsE PE=3 SV=1 461 616 1.0E-08
sp|B8EBI8|RS5_SHEB2 30S ribosomal protein S5 OS=Shewanella baltica (strain OS223) GN=rpsE PE=3 SV=1 461 616 1.0E-08
sp|Q664T8|RS5_YERPS 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsE PE=3 SV=1 456 615 1.0E-08
sp|A4TH09|RS5_YERPP 30S ribosomal protein S5 OS=Yersinia pestis (strain Pestoides F) GN=rpsE PE=3 SV=1 456 615 1.0E-08
sp|Q1CCW1|RS5_YERPN 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsE PE=3 SV=1 456 615 1.0E-08
sp|Q8ZJ95|RS5_YERPE 30S ribosomal protein S5 OS=Yersinia pestis GN=rpsE PE=3 SV=1 456 615 1.0E-08
sp|Q1C2W4|RS5_YERPA 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsE PE=3 SV=1 456 615 1.0E-08
sp|A7FNL7|RS5_YERP3 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsE PE=3 SV=1 456 615 1.0E-08
sp|A1RED1|RS5_SHESW 30S ribosomal protein S5 OS=Shewanella sp. (strain W3-18-1) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|A4YBW6|RS5_SHEPC 30S ribosomal protein S5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|Q089N7|RS5_SHEFN 30S ribosomal protein S5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|Q12SU2|RS5_SHEDO 30S ribosomal protein S5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|Q73HA3|RS5_WOLPM 30S ribosomal protein S5 OS=Wolbachia pipientis wMel GN=rpsE PE=3 SV=1 453 615 2.0E-08
sp|Q9Z7S3|RS5_CHLPN 30S ribosomal protein S5 OS=Chlamydia pneumoniae GN=rpsE PE=3 SV=1 461 595 2.0E-08
sp|Q0I088|RS5_SHESR 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-7) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|Q0HNS0|RS5_SHESM 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-4) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|A0KRP1|RS5_SHESA 30S ribosomal protein S5 OS=Shewanella sp. (strain ANA-3) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|P59124|RS5_SHEON 30S ribosomal protein S5 OS=Shewanella oneidensis (strain MR-1) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|Q4JT86|RS5_CORJK 30S ribosomal protein S5 OS=Corynebacterium jeikeium (strain K411) GN=rpsE PE=3 SV=1 456 615 2.0E-08
sp|C3LRP1|RS5_VIBCM 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsE PE=3 SV=1 461 609 2.0E-08
sp|Q9KP01|RS5_VIBCH 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsE PE=3 SV=1 461 609 2.0E-08
sp|A5F563|RS5_VIBC3 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsE PE=3 SV=1 461 609 2.0E-08
sp|A4WFB1|RS5_ENT38 30S ribosomal protein S5 OS=Enterobacter sp. (strain 638) GN=rpsE PE=3 SV=1 456 615 2.0E-08
sp|C1B029|RS5_RHOOB 30S ribosomal protein S5 OS=Rhodococcus opacus (strain B4) GN=rpsE PE=3 SV=1 459 615 2.0E-08
sp|Q0S3F9|RS5_RHOJR 30S ribosomal protein S5 OS=Rhodococcus jostii (strain RHA1) GN=rpsE PE=3 SV=1 459 615 2.0E-08
sp|Q749A4|RS5_GEOSL 30S ribosomal protein S5 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsE PE=3 SV=1 460 609 2.0E-08
sp|Q2RQX7|RS5_RHORT 30S ribosomal protein S5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsE PE=3 SV=1 471 615 2.0E-08
sp|A6GZ82|RS5_FLAPJ 30S ribosomal protein S5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsE PE=3 SV=1 471 621 2.0E-08
sp|Q2N9C8|RS5_ERYLH 30S ribosomal protein S5 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsE PE=3 SV=1 471 615 2.0E-08
sp|A3Q999|RS5_SHELP 30S ribosomal protein S5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsE PE=3 SV=1 461 616 2.0E-08
sp|Q28UT7|RS5_JANSC 30S ribosomal protein S5 OS=Jannaschia sp. (strain CCS1) GN=rpsE PE=3 SV=1 466 615 3.0E-08
sp|B8G6Q8|RS5_CHLAD 30S ribosomal protein S5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsE PE=3 SV=1 457 605 3.0E-08
sp|Q6LV99|RS5_PHOPR 30S ribosomal protein S5 OS=Photobacterium profundum GN=rpsE PE=3 SV=1 456 615 3.0E-08
sp|B8DW30|RS5_BIFA0 30S ribosomal protein S5 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpsE PE=3 SV=1 461 615 3.0E-08
sp|A8LM74|RS5_DINSH 30S ribosomal protein S5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsE PE=3 SV=1 471 617 4.0E-08
sp|Q8NSX5|RS5_CORGL 30S ribosomal protein S5 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsE PE=3 SV=1 456 615 4.0E-08
sp|A4QBL3|RS5_CORGB 30S ribosomal protein S5 OS=Corynebacterium glutamicum (strain R) GN=rpsE PE=3 SV=1 456 615 4.0E-08
sp|Q7MTN0|RS5_PORGI 30S ribosomal protein S5 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsE PE=3 SV=1 444 621 4.0E-08
sp|Q3YRM6|RS5_EHRCJ 30S ribosomal protein S5 OS=Ehrlichia canis (strain Jake) GN=rpsE PE=3 SV=1 466 615 4.0E-08
sp|Q7MYG8|RS5_PHOLL 30S ribosomal protein S5 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsE PE=3 SV=1 456 615 4.0E-08
sp|B0V6W2|RS5_ACIBY 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AYE) GN=rpsE PE=3 SV=1 459 616 4.0E-08
sp|B0VQT5|RS5_ACIBS 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain SDF) GN=rpsE PE=3 SV=1 459 616 4.0E-08
sp|B2HZ91|RS5_ACIBC 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ACICU) GN=rpsE PE=3 SV=1 459 616 4.0E-08
sp|B7IA22|RS5_ACIB5 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB0057) GN=rpsE PE=3 SV=1 459 616 4.0E-08
sp|B7GW19|RS5_ACIB3 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsE PE=3 SV=1 459 616 4.0E-08
sp|B5ELZ6|RS5_ACIF5 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsE PE=3 SV=1 460 616 4.0E-08
sp|B7J484|RS5_ACIF2 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsE PE=3 SV=1 460 616 4.0E-08
sp|A3M967|RS5_ACIBT 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsE PE=3 SV=2 459 616 4.0E-08
sp|Q47LL0|RS5_THEFY 30S ribosomal protein S5 OS=Thermobifida fusca (strain YX) GN=rpsE PE=3 SV=1 471 615 4.0E-08
sp|Q3J8T1|RS5_NITOC 30S ribosomal protein S5 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsE PE=3 SV=1 461 615 4.0E-08
sp|Q9A8T6|RS5_CAUCR 30S ribosomal protein S5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsE PE=3 SV=1 461 615 5.0E-08
sp|B8H4F1|RS5_CAUCN 30S ribosomal protein S5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsE PE=3 SV=1 461 615 5.0E-08
sp|Q6AD11|RS5_LEIXX 30S ribosomal protein S5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsE PE=3 SV=1 459 609 5.0E-08
sp|B0T2D9|RS5_CAUSK 30S ribosomal protein S5 OS=Caulobacter sp. (strain K31) GN=rpsE PE=3 SV=1 471 615 6.0E-08
sp|Q2GH39|RS5_EHRCR 30S ribosomal protein S5 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsE PE=3 SV=1 466 615 6.0E-08
sp|Q5NQ48|RS5_ZYMMO 30S ribosomal protein S5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsE PE=3 SV=1 461 615 6.0E-08
sp|Q488Z6|RS5_COLP3 30S ribosomal protein S5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsE PE=3 SV=1 464 615 6.0E-08
sp|B0U5L6|RS5_XYLFM 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M12) GN=rpsE PE=3 SV=1 464 614 7.0E-08
sp|Q5L704|RS5_CHLAB 30S ribosomal protein S5 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsE PE=3 SV=1 461 596 7.0E-08
sp|A8GKI0|RS5_SERP5 30S ribosomal protein S5 OS=Serratia proteamaculans (strain 568) GN=rpsE PE=3 SV=1 456 615 8.0E-08
sp|Q5GSW1|RS5_WOLTR 30S ribosomal protein S5 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsE PE=3 SV=1 466 615 8.0E-08
sp|A5FZU8|RS5_ACICJ 30S ribosomal protein S5 OS=Acidiphilium cryptum (strain JF-5) GN=rpsE PE=3 SV=1 461 615 8.0E-08
sp|B4RT45|RS5_ALTMD 30S ribosomal protein S5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsE PE=3 SV=1 464 615 8.0E-08
sp|B1VEX2|RS5_CORU7 30S ribosomal protein S5 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpsE PE=3 SV=1 456 615 8.0E-08
sp|C3PL26|RS5_CORA7 30S ribosomal protein S5 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rpsE PE=3 SV=1 462 615 9.0E-08
sp|Q605C9|RS5_METCA 30S ribosomal protein S5 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsE PE=3 SV=1 459 609 9.0E-08
sp|Q1GK12|RS5_RUEST 30S ribosomal protein S5 OS=Ruegeria sp. (strain TM1040) GN=rpsE PE=3 SV=1 471 615 9.0E-08
sp|A0LIK7|RS5_SYNFM 30S ribosomal protein S5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsE PE=3 SV=1 461 616 1.0E-07
sp|Q5Z1Q5|RS5_NOCFA 30S ribosomal protein S5 OS=Nocardia farcinica (strain IFM 10152) GN=rpsE PE=3 SV=1 459 615 1.0E-07
sp|B6EPU2|RS5_ALISL 30S ribosomal protein S5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsE PE=3 SV=1 445 609 1.0E-07
sp|C0ZW43|RS5_RHOE4 30S ribosomal protein S5 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsE PE=3 SV=1 459 615 1.0E-07
sp|B9LJE9|RS5_CHLSY 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsE PE=3 SV=1 471 605 1.0E-07
sp|A9WH83|RS5_CHLAA 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsE PE=3 SV=1 471 605 1.0E-07
sp|Q252W9|RS5_CHLFF 30S ribosomal protein S5 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsE PE=3 SV=1 461 596 1.0E-07
sp|A5CXM1|RS5_VESOH 30S ribosomal protein S5 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsE PE=3 SV=1 464 609 1.0E-07
sp|Q6F7S9|RS5_ACIAD 30S ribosomal protein S5 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsE PE=3 SV=1 459 609 1.0E-07
sp|Q9PE59|RS5_XYLFA 30S ribosomal protein S5 OS=Xylella fastidiosa (strain 9a5c) GN=rpsE PE=3 SV=1 464 612 2.0E-07
sp|A1ALV8|RS5_PELPD 30S ribosomal protein S5 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsE PE=3 SV=1 471 609 2.0E-07
sp|Q8FS52|RS5_COREF 30S ribosomal protein S5 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rpsE PE=3 SV=1 456 615 2.0E-07
sp|A4IZR7|RS5_FRATW 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsE PE=3 SV=1 454 616 2.0E-07
sp|Q5NHV1|RS5_FRATT 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsE PE=3 SV=1 454 616 2.0E-07
sp|Q0BNR0|RS5_FRATO 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsE PE=3 SV=1 454 616 2.0E-07
sp|A0Q4K0|RS5_FRATN 30S ribosomal protein S5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsE PE=3 SV=1 454 616 2.0E-07
sp|A7N9U2|RS5_FRATF 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsE PE=3 SV=1 454 616 2.0E-07
sp|Q14JA3|RS5_FRAT1 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsE PE=3 SV=1 454 616 2.0E-07
sp|Q68W95|RS5_RICTY 30S ribosomal protein S5 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsE PE=3 SV=1 471 615 2.0E-07
sp|B5FG26|RS5_VIBFM 30S ribosomal protein S5 OS=Vibrio fischeri (strain MJ11) GN=rpsE PE=3 SV=1 445 609 2.0E-07
sp|Q5E897|RS5_VIBF1 30S ribosomal protein S5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsE PE=3 SV=1 445 609 2.0E-07
sp|Q87E65|RS5_XYLFT 30S ribosomal protein S5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsE PE=3 SV=1 464 614 2.0E-07
sp|B2I8I6|RS5_XYLF2 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M23) GN=rpsE PE=3 SV=1 464 614 2.0E-07
sp|Q2A5F3|RS5_FRATH 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsE PE=3 SV=1 454 616 2.0E-07
sp|P0A4C8|RS5_CHLTR 30S ribosomal protein S5 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsE PE=3 SV=1 461 596 3.0E-07
sp|Q3KLI5|RS5_CHLTA 30S ribosomal protein S5 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsE PE=3 SV=1 461 596 3.0E-07
sp|P0A4C9|RS5_CHLMU 30S ribosomal protein S5 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsE PE=3 SV=1 461 596 3.0E-07
sp|B4R8N4|RS5_PHEZH 30S ribosomal protein S5 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsE PE=3 SV=1 461 615 3.0E-07
sp|Q12G86|RS5_POLSJ 30S ribosomal protein S5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsE PE=3 SV=1 461 615 3.0E-07
sp|Q2S929|RS5_HAHCH 30S ribosomal protein S5 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsE PE=3 SV=1 450 615 3.0E-07
sp|Q8A493|RS5_BACTN 30S ribosomal protein S5 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsE PE=3 SV=1 446 621 3.0E-07
sp|A6LEH4|RS5_PARD8 30S ribosomal protein S5 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsE PE=3 SV=1 446 621 3.0E-07
sp|A1JS11|RS5_YERE8 30S ribosomal protein S5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsE PE=3 SV=1 456 615 3.0E-07
sp|A0PM82|RS5_MYCUA 30S ribosomal protein S5 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsE PE=3 SV=1 459 615 4.0E-07
sp|A6TEV5|RS5_KLEP7 30S ribosomal protein S5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsE PE=3 SV=1 456 615 4.0E-07
sp|B5ZB57|RS5_UREU1 30S ribosomal protein S5 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsE PE=3 SV=1 469 612 4.0E-07
sp|Q2GL42|RS5_ANAPZ 30S ribosomal protein S5 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsE PE=3 SV=1 478 615 4.0E-07
sp|B2HCT8|RS5_MYCMM 30S ribosomal protein S5 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsE PE=3 SV=1 459 615 5.0E-07
sp|Q15X56|RS5_PSEA6 30S ribosomal protein S5 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsE PE=3 SV=1 450 615 5.0E-07
sp|Q5HAT9|RS5_EHRRW 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsE PE=3 SV=1 466 615 5.0E-07
sp|Q5FFR5|RS5_EHRRG 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsE PE=3 SV=2 466 615 5.0E-07
sp|A5V5Y5|RS5_SPHWW 30S ribosomal protein S5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsE PE=3 SV=1 461 615 6.0E-07
sp|Q1QDG9|RS5_PSYCK 30S ribosomal protein S5 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsE PE=3 SV=1 471 612 6.0E-07
sp|Q4FUD9|RS5_PSYA2 30S ribosomal protein S5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsE PE=3 SV=1 471 612 6.0E-07
sp|Q9PQP3|RS5_UREPA 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsE PE=3 SV=1 469 615 6.0E-07
sp|B1AIN7|RS5_UREP2 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsE PE=3 SV=1 469 615 6.0E-07
sp|B2T734|RS5_BURPP 30S ribosomal protein S5 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsE PE=3 SV=1 460 615 6.0E-07
sp|P9WH33|RS5_MYCTU 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsE PE=1 SV=1 459 615 7.0E-07
sp|P9WH32|RS5_MYCTO 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsE PE=3 SV=1 459 615 7.0E-07
sp|A5U0A7|RS5_MYCTA 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsE PE=3 SV=1 459 615 7.0E-07
sp|C1AL55|RS5_MYCBT 30S ribosomal protein S5 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsE PE=3 SV=1 459 615 7.0E-07
sp|A1KGK2|RS5_MYCBP 30S ribosomal protein S5 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsE PE=3 SV=1 459 615 7.0E-07
sp|P66575|RS5_MYCBO 30S ribosomal protein S5 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsE PE=3 SV=1 459 615 7.0E-07
sp|A4JAQ7|RS5_BURVG 30S ribosomal protein S5 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsE PE=3 SV=1 460 615 7.0E-07
sp|Q0BJ29|RS5_BURCM 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsE PE=3 SV=1 460 615 7.0E-07
sp|A0K3P2|RS5_BURCH 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsE PE=3 SV=1 460 615 7.0E-07
sp|B1JU39|RS5_BURCC 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsE PE=3 SV=1 460 615 7.0E-07
sp|Q1BRW5|RS5_BURCA 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsE PE=3 SV=1 460 615 7.0E-07
sp|B1YRP6|RS5_BURA4 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsE PE=3 SV=1 460 615 7.0E-07
sp|Q65QX2|RS5_MANSM 30S ribosomal protein S5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsE PE=3 SV=1 456 612 7.0E-07
sp|A4TED4|RS5_MYCGI 30S ribosomal protein S5 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpsE PE=3 SV=1 459 615 7.0E-07
sp|Q824N5|RS5_CHLCV 30S ribosomal protein S5 OS=Chlamydophila caviae (strain GPIC) GN=rpsE PE=3 SV=1 461 604 8.0E-07
sp|C4LL09|RS5_CORK4 30S ribosomal protein S5 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsE PE=3 SV=1 462 615 8.0E-07
sp|A1B044|RS5_PARDP 30S ribosomal protein S5 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsE PE=3 SV=1 471 615 8.0E-07
sp|Q5QXW2|RS5_IDILO 30S ribosomal protein S5 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsE PE=3 SV=1 461 612 8.0E-07
sp|B2JI48|RS5_BURP8 30S ribosomal protein S5 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsE PE=3 SV=1 460 615 8.0E-07
sp|A1AVL7|RS5_RUTMC 30S ribosomal protein S5 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsE PE=3 SV=1 464 617 8.0E-07
sp|A0QSG6|RS5_MYCS2 30S ribosomal protein S5 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsE PE=1 SV=1 459 615 9.0E-07
sp|Q39XY9|RS5_GEOMG 30S ribosomal protein S5 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsE PE=3 SV=1 460 609 9.0E-07
sp|A2SLE0|RS5_METPP 30S ribosomal protein S5 OS=Methylibium petroleiphilum (strain PM1) GN=rpsE PE=3 SV=1 460 612 1.0E-06
sp|Q13TI7|RS5_BURXL 30S ribosomal protein S5 OS=Burkholderia xenovorans (strain LB400) GN=rpsE PE=3 SV=1 460 615 1.0E-06
sp|Q64NM5|RS5_BACFR 30S ribosomal protein S5 OS=Bacteroides fragilis (strain YCH46) GN=rpsE PE=3 SV=1 452 621 1.0E-06
sp|Q5L8C6|RS5_BACFN 30S ribosomal protein S5 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsE PE=3 SV=1 452 621 1.0E-06
sp|Q6ME47|RS5_PARUW 30S ribosomal protein S5 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsE PE=3 SV=1 461 609 1.0E-06
sp|A0LRN7|RS5_ACIC1 30S ribosomal protein S5 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpsE PE=3 SV=1 459 615 1.0E-06
sp|A8F2D0|RS5_RICM5 30S ribosomal protein S5 OS=Rickettsia massiliae (strain Mtu5) GN=rpsE PE=3 SV=2 471 615 1.0E-06
sp|P44374|RS5_HAEIN 30S ribosomal protein S5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsE PE=3 SV=1 456 612 1.0E-06
sp|A5UHU8|RS5_HAEIG 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittGG) GN=rpsE PE=3 SV=1 456 612 1.0E-06
sp|A5UDT0|RS5_HAEIE 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittEE) GN=rpsE PE=3 SV=1 456 612 1.0E-06
sp|Q4QMA4|RS5_HAEI8 30S ribosomal protein S5 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsE PE=3 SV=1 456 612 1.0E-06
sp|B1MGC5|RS5_MYCA9 30S ribosomal protein S5 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpsE PE=3 SV=1 459 615 1.0E-06
sp|B0UX31|RS5_HISS2 30S ribosomal protein S5 OS=Histophilus somni (strain 2336) GN=rpsE PE=3 SV=1 456 612 1.0E-06
sp|Q0I145|RS5_HAES1 30S ribosomal protein S5 OS=Haemophilus somnus (strain 129Pt) GN=rpsE PE=3 SV=1 456 612 1.0E-06
sp|A3N374|RS5_ACTP2 30S ribosomal protein S5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsE PE=3 SV=1 456 615 1.0E-06
sp|Q9ZCS2|RS5_RICPR 30S ribosomal protein S5 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsE PE=3 SV=1 471 615 1.0E-06
sp|Q0BYD1|RS5_HYPNA 30S ribosomal protein S5 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsE PE=3 SV=1 461 615 2.0E-06
sp|A9BRW8|RS5_DELAS 30S ribosomal protein S5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsE PE=3 SV=1 460 615 2.0E-06
sp|Q73S92|RS5_MYCPA 30S ribosomal protein S5 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsE PE=3 SV=1 459 615 2.0E-06
sp|A1VJ32|RS5_POLNA 30S ribosomal protein S5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsE PE=3 SV=1 461 615 2.0E-06
sp|Q6A6P3|RS5_PROAC 30S ribosomal protein S5 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpsE PE=3 SV=1 471 615 2.0E-06
sp|A7HWS8|RS5_PARL1 30S ribosomal protein S5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsE PE=3 SV=1 467 615 2.0E-06
sp|Q9CL47|RS5_PASMU 30S ribosomal protein S5 OS=Pasteurella multocida (strain Pm70) GN=rpsE PE=3 SV=1 456 612 2.0E-06
sp|A8EZJ9|RS5_RICCK 30S ribosomal protein S5 OS=Rickettsia canadensis (strain McKiel) GN=rpsE PE=3 SV=1 478 615 2.0E-06
sp|A6KYH8|RS5_BACV8 30S ribosomal protein S5 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsE PE=3 SV=1 452 621 3.0E-06
sp|A6U876|RS5_SINMW 30S ribosomal protein S5 OS=Sinorhizobium medicae (strain WSM419) GN=rpsE PE=3 SV=1 436 611 3.0E-06
sp|Q92QF3|RS5_RHIME 30S ribosomal protein S5 OS=Rhizobium meliloti (strain 1021) GN=rpsE PE=3 SV=1 436 611 3.0E-06
sp|Q16AC7|RS5_ROSDO 30S ribosomal protein S5 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsE PE=3 SV=1 471 615 3.0E-06
sp|Q73PL5|RS5_TREDE 30S ribosomal protein S5 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsE PE=3 SV=1 478 615 3.0E-06
sp|Q39KF0|RS5_BURL3 30S ribosomal protein S5 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|B4E5D7|RS5_BURCJ 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|Q2LQC0|RS5_SYNAS 30S ribosomal protein S5 OS=Syntrophus aciditrophicus (strain SB) GN=rpsE PE=3 SV=1 453 615 3.0E-06
sp|B3E847|RS5_GEOLS 30S ribosomal protein S5 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsE PE=3 SV=1 471 609 3.0E-06
sp|C1DAT4|RS5_LARHH 30S ribosomal protein S5 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsE PE=3 SV=1 461 615 3.0E-06
sp|A1T0C5|RS5_PSYIN 30S ribosomal protein S5 OS=Psychromonas ingrahamii (strain 37) GN=rpsE PE=3 SV=1 461 609 3.0E-06
sp|A5D5H1|RS5_PELTS 30S ribosomal protein S5 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsE PE=3 SV=1 464 610 3.0E-06
sp|Q63Q28|RS5_BURPS 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain K96243) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|A3NEG2|RS5_BURP6 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 668) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|Q3JMT0|RS5_BURP1 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|A3P096|RS5_BURP0 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|A1V886|RS5_BURMS 30S ribosomal protein S5 OS=Burkholderia mallei (strain SAVP1) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|Q62GM2|RS5_BURMA 30S ribosomal protein S5 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|A2S7J3|RS5_BURM9 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|A3MRX1|RS5_BURM7 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|A9ADL0|RS5_BURM1 30S ribosomal protein S5 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsE PE=3 SV=1 460 615 3.0E-06
sp|A6VLK5|RS5_ACTSZ 30S ribosomal protein S5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsE PE=3 SV=1 456 612 3.0E-06
sp|Q0ANR7|RS5_MARMM 30S ribosomal protein S5 OS=Maricaulis maris (strain MCS10) GN=rpsE PE=3 SV=1 461 615 4.0E-06
sp|A8IAP6|RS5_AZOC5 30S ribosomal protein S5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsE PE=3 SV=1 452 612 4.0E-06
sp|Q8RIH3|RS5_FUSNN 30S ribosomal protein S5 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsE PE=3 SV=1 471 615 4.0E-06
sp|Q21QP0|RS5_RHOFT 30S ribosomal protein S5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsE PE=3 SV=1 460 612 5.0E-06
sp|A4G9S1|RS5_HERAR 30S ribosomal protein S5 OS=Herminiimonas arsenicoxydans GN=rpsE PE=3 SV=1 464 615 5.0E-06
sp|Q2SU44|RS5_BURTA 30S ribosomal protein S5 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsE PE=3 SV=1 460 615 5.0E-06
sp|A5USH2|RS5_ROSS1 30S ribosomal protein S5 OS=Roseiflexus sp. (strain RS-1) GN=rpsE PE=3 SV=1 471 609 5.0E-06
sp|A4J128|RS5_DESRM 30S ribosomal protein S5 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsE PE=3 SV=1 461 612 5.0E-06
sp|Q8UE35|RS5_AGRFC 30S ribosomal protein S5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsE PE=3 SV=1 436 611 6.0E-06
sp|B1LBM3|RS5_THESQ 30S ribosomal protein S5 OS=Thermotoga sp. (strain RQ2) GN=rpsE PE=3 SV=1 469 605 6.0E-06
sp|A5IMA0|RS5_THEP1 30S ribosomal protein S5 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsE PE=3 SV=1 469 605 6.0E-06
sp|C3PP90|RS5_RICAE 30S ribosomal protein S5 OS=Rickettsia africae (strain ESF-5) GN=rpsE PE=3 SV=1 471 615 6.0E-06
sp|B9JVQ4|RS5_AGRVS 30S ribosomal protein S5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsE PE=3 SV=1 436 611 6.0E-06
sp|B2S2F3|RS5_TREPS 30S ribosomal protein S5 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsE PE=3 SV=1 478 615 7.0E-06
sp|O83236|RS5_TREPA 30S ribosomal protein S5 OS=Treponema pallidum (strain Nichols) GN=rpsE PE=3 SV=1 478 615 7.0E-06
sp|Q31IW5|RS5_THICR 30S ribosomal protein S5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsE PE=3 SV=1 460 612 7.0E-06
sp|A8GT52|RS5_RICRS 30S ribosomal protein S5 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsE PE=3 SV=1 471 612 7.0E-06
sp|B0BUP3|RS5_RICRO 30S ribosomal protein S5 OS=Rickettsia rickettsii (strain Iowa) GN=rpsE PE=3 SV=1 471 612 7.0E-06
sp|B2UEK2|RS5_RALPJ 30S ribosomal protein S5 OS=Ralstonia pickettii (strain 12J) GN=rpsE PE=3 SV=1 460 615 7.0E-06
sp|Q92GY3|RS5_RICCN 30S ribosomal protein S5 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsE PE=3 SV=1 471 615 8.0E-06
sp|Q1GPB6|RS5_SPHAL 30S ribosomal protein S5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsE PE=3 SV=1 461 617 8.0E-06
sp|Q98PZ9|RS5_MYCPU 30S ribosomal protein S5 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsE PE=3 SV=1 467 615 8.0E-06
sp|Q0BUN3|RS5_GRABC 30S ribosomal protein S5 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsE PE=3 SV=1 464 615 8.0E-06
sp|Q1R0F8|RS5_CHRSD 30S ribosomal protein S5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsE PE=3 SV=1 461 609 9.0E-06
sp|C4K2G2|RS5_RICPU 30S ribosomal protein S5 OS=Rickettsia peacockii (strain Rustic) GN=rpsE PE=3 SV=1 471 612 9.0E-06
sp|Q5LW41|RS5_RUEPO 30S ribosomal protein S5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsE PE=3 SV=1 471 615 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:1901363 heterocyclic compound binding No
GO:0019538 protein metabolic process No
GO:0003676 nucleic acid binding No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0009987 cellular process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006518 peptide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2639
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4771 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7509
Ophiocordyceps camponoti-floridani Ophcf2|06584
Ophiocordyceps camponoti-rufipedis Ophun1|3222
Ophiocordyceps kimflemingae Ophio5|7410
Ophiocordyceps subramaniannii Hirsu2|4046

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4771
MNASRPAVQTLLLGRRCLPSTKSLAKSTVAPPQPCPVATCARRFFQTTPAVRGKRKSRFRNVKAADLGLLRPKRR
AAYIKQKFPDYTAADFEELSKKYSPEQLEAIRAGEAAIDPDDLIFQGRLRDDPYRPDYIEDYSVLDPRYDIRANE
IDGDDNNVKPDLPKWQQFDEWIDDYGARMTKLMEKKTDQQILRAMIRALHRVKDSHGVDLIDLTPDELQDLEQDP
ELLIKYVQKKDGQTRSKMRRGSTPHGDSSELNALVDAKKREVDAYKRRKAEERKMLLAGEAAEGEEALEKPVAAM
GIDPQADGSQAEEHSQAEPDGSLAEELSQAEPDGSANEARGSSTSNDTMASATTETDARQEIERLQESIKEIDQA
VDAEFAKEMEKVLDESDRVIMPSNLELLEHGPGGRSQLDSVEMPDLGKVPGVEGLYNKSDEEKDITQSYKQLRQL
TDMDIKDLKSLYTKSIVTRYVSNQTRLGKVESASVVAIAGNGNGLLGLGIAKSTDIGVAIETAKMLAIRNMKPIP
RYENRTIFGNVKVKISGTIVEMFTRPPGFGLRCPERIFEMCRAAGLHDMSVRIPRSRNAMNSVKAAYQALLKQPD
PEEIALGRGRKLVDVRKVYYGGSVH*
Coding >OphauG2|4771
ATGAACGCCTCACGCCCTGCCGTACAGACGCTCCTCCTCGGTCGGAGGTGTTTACCTTCAACAAAGTCGCTGGCC
AAGTCGACAGTTGCACCACCACAGCCATGTCCAGTGGCAACATGCGCCCGCCGCTTCTTCCAGACAACACCAGCT
GTCCGTGGTAAGCGGAAGTCGCGCTTCCGCAACGTCAAGGCGGCCGATCTGGGGCTGCTTCGTCCCAAACGCAGA
GCGGCGTATATCAAGCAAAAATTCCCCGACTATACGGCCGCCGACTTTGAGGAGCTGAGCAAGAAGTACTCTCCG
GAGCAGCTCGAGGCCATTCGTGCGGGAGAAGCGGCCATTGATCCCGACGACTTGATATTCCAGGGTCGTCTCCGC
GATGACCCATACCGCCCCGACTATATCGAAGACTATTCAGTCCTCGATCCTCGCTACGATATCCGTGCAAACGAG
ATTGATGGCGATGACAATAATGTCAAGCCAGACCTACCAAAGTGGCAGCAATTCGATGAATGGATTGACGATTAC
GGCGCACGCATGACCAAGTTGATGGAAAAGAAGACGGATCAACAGATTCTTCGAGCCATGATCCGTGCTCTGCAC
AGAGTCAAGGATAGCCATGGAGTGGATCTGATTGATCTGACTCCCGATGAGCTTCAAGACCTGGAACAGGATCCT
GAACTGCTCATCAAGTACGTCCAAAAGAAAGACGGCCAGACTAGGTCAAAAATGAGGCGAGGCTCGACACCGCAT
GGTGACTCGTCAGAGCTCAATGCGCTTGTTGACGCCAAGAAGCGAGAGGTAGACGCATACAAGAGGAGGAAAGCC
GAGGAAAGAAAAATGCTGCTTGCTGGCGAGGCTGCAGAGGGAGAGGAGGCATTGGAGAAGCCCGTCGCAGCCATG
GGTATTGACCCTCAGGCTGATGGCTCTCAAGCTGAGGAGCACAGCCAGGCGGAACCAGATGGCTCTCTAGCTGAG
GAGCTCAGTCAGGCGGAACCAGATGGCTCGGCAAATGAAGCTCGAGGGTCCTCGACGTCAAATGACACCATGGCA
TCGGCCACGACAGAGACGGATGCGAGACAAGAGATTGAGAGGCTCCAGGAATCAATCAAGGAAATCGACCAGGCA
GTTGATGCAGAGTTTGCCAAAGAAATGGAGAAAGTTCTGGATGAGAGCGATCGGGTAATAATGCCCAGCAATCTT
GAGCTCCTTGAGCATGGGCCAGGCGGCAGAAGCCAGCTTGACTCGGTTGAGATGCCTGATCTGGGCAAGGTGCCG
GGCGTCGAGGGTCTCTACAATAAGAGTGATGAGGAAAAGGATATAACACAGTCTTACAAGCAACTGCGACAGTTG
ACCGACATGGACATCAAGGATCTCAAGTCGCTCTACACCAAGAGCATTGTGACGCGCTATGTATCCAACCAGACG
CGTCTGGGAAAGGTGGAAAGCGCATCCGTGGTGGCCATTGCGGGCAACGGGAATGGGCTCTTGGGACTGGGTATA
GCAAAGTCGACGGATATTGGCGTGGCAATCGAGACGGCCAAGATGTTGGCGATTCGCAACATGAAGCCGATTCCG
CGCTACGAAAACCGCACCATTTTTGGCAATGTCAAGGTCAAGATATCGGGGACAATTGTTGAGATGTTTACCCGG
CCTCCTGGTTTTGGTCTCCGCTGTCCCGAACGCATCTTCGAAATGTGTCGCGCGGCGGGACTGCATGACATGTCG
GTGCGCATCCCTCGGTCGAGAAACGCCATGAACTCGGTCAAGGCTGCATATCAGGCACTTTTGAAGCAGCCGGAT
CCTGAGGAGATTGCCCTGGGGCGCGGGCGGAAGCTGGTTGATGTGAGAAAAGTGTACTATGGCGGGTCGGTGCAT
TGA
Transcript >OphauG2|4771
ATGAACGCCTCACGCCCTGCCGTACAGACGCTCCTCCTCGGTCGGAGGTGTTTACCTTCAACAAAGTCGCTGGCC
AAGTCGACAGTTGCACCACCACAGCCATGTCCAGTGGCAACATGCGCCCGCCGCTTCTTCCAGACAACACCAGCT
GTCCGTGGTAAGCGGAAGTCGCGCTTCCGCAACGTCAAGGCGGCCGATCTGGGGCTGCTTCGTCCCAAACGCAGA
GCGGCGTATATCAAGCAAAAATTCCCCGACTATACGGCCGCCGACTTTGAGGAGCTGAGCAAGAAGTACTCTCCG
GAGCAGCTCGAGGCCATTCGTGCGGGAGAAGCGGCCATTGATCCCGACGACTTGATATTCCAGGGTCGTCTCCGC
GATGACCCATACCGCCCCGACTATATCGAAGACTATTCAGTCCTCGATCCTCGCTACGATATCCGTGCAAACGAG
ATTGATGGCGATGACAATAATGTCAAGCCAGACCTACCAAAGTGGCAGCAATTCGATGAATGGATTGACGATTAC
GGCGCACGCATGACCAAGTTGATGGAAAAGAAGACGGATCAACAGATTCTTCGAGCCATGATCCGTGCTCTGCAC
AGAGTCAAGGATAGCCATGGAGTGGATCTGATTGATCTGACTCCCGATGAGCTTCAAGACCTGGAACAGGATCCT
GAACTGCTCATCAAGTACGTCCAAAAGAAAGACGGCCAGACTAGGTCAAAAATGAGGCGAGGCTCGACACCGCAT
GGTGACTCGTCAGAGCTCAATGCGCTTGTTGACGCCAAGAAGCGAGAGGTAGACGCATACAAGAGGAGGAAAGCC
GAGGAAAGAAAAATGCTGCTTGCTGGCGAGGCTGCAGAGGGAGAGGAGGCATTGGAGAAGCCCGTCGCAGCCATG
GGTATTGACCCTCAGGCTGATGGCTCTCAAGCTGAGGAGCACAGCCAGGCGGAACCAGATGGCTCTCTAGCTGAG
GAGCTCAGTCAGGCGGAACCAGATGGCTCGGCAAATGAAGCTCGAGGGTCCTCGACGTCAAATGACACCATGGCA
TCGGCCACGACAGAGACGGATGCGAGACAAGAGATTGAGAGGCTCCAGGAATCAATCAAGGAAATCGACCAGGCA
GTTGATGCAGAGTTTGCCAAAGAAATGGAGAAAGTTCTGGATGAGAGCGATCGGGTAATAATGCCCAGCAATCTT
GAGCTCCTTGAGCATGGGCCAGGCGGCAGAAGCCAGCTTGACTCGGTTGAGATGCCTGATCTGGGCAAGGTGCCG
GGCGTCGAGGGTCTCTACAATAAGAGTGATGAGGAAAAGGATATAACACAGTCTTACAAGCAACTGCGACAGTTG
ACCGACATGGACATCAAGGATCTCAAGTCGCTCTACACCAAGAGCATTGTGACGCGCTATGTATCCAACCAGACG
CGTCTGGGAAAGGTGGAAAGCGCATCCGTGGTGGCCATTGCGGGCAACGGGAATGGGCTCTTGGGACTGGGTATA
GCAAAGTCGACGGATATTGGCGTGGCAATCGAGACGGCCAAGATGTTGGCGATTCGCAACATGAAGCCGATTCCG
CGCTACGAAAACCGCACCATTTTTGGCAATGTCAAGGTCAAGATATCGGGGACAATTGTTGAGATGTTTACCCGG
CCTCCTGGTTTTGGTCTCCGCTGTCCCGAACGCATCTTCGAAATGTGTCGCGCGGCGGGACTGCATGACATGTCG
GTGCGCATCCCTCGGTCGAGAAACGCCATGAACTCGGTCAAGGCTGCATATCAGGCACTTTTGAAGCAGCCGGAT
CCTGAGGAGATTGCCCTGGGGCGCGGGCGGAAGCTGGTTGATGTGAGAAAAGTGTACTATGGCGGGTCGGTGCAT
TGA
Gene >OphauG2|4771
ATGAACGCCTCACGCCCTGCCGTACAGACGCTCCTCCTCGGTCGGAGGTGTTTACCTTCAACAAAGTCGCTGGCC
AAGTCGACAGTTGCACCACCACAGCCATGTCCAGTGGCAACATGCGCCCGCCGCTTCTTCCAGACAACACCAGCT
GTCCGTGGTAAGCGGAAGTCGCGCTTCCGCAACGTCAAGGCGGCCGATCTGGGGCTGCTTCGTCCCAAACGCAGA
GCGGCGTATATCAAGCAAAAATTCCCCGACTATACGGCCGCCGACTTTGAGGAGCTGAGCAAGAAGTACTCTCCG
GAGCAGCTCGAGGCCATTCGTGCGGGAGAAGCGGCCATTGATCCCGACGACTTGATATTCCAGGGTCGTCTCCGC
GATGACCCATACCGCCCCGACTATATCGAAGACTATTCAGTCCTCGATCCTCGCTACGATATCCGTGCAAACGAG
ATTGATGGCGATGACAATAATGTCAAGCCAGACCTACCAAAGTGGCAGCAATTCGATGAATGGATTGACGATTAC
GGCGCACGCATGACCAAGTTGATGGAAAAGAAGACGGATCAACAGATTCTTCGAGCCATGATCCGTGCTCTGCAC
AGAGTCAAGGATAGCCATGGAGTGGATCTGATTGATCTGACTCCCGATGAGCTTCAAGACCTGGAACAGGATCCT
GAACTGCTCATCAAGTACGTCCAAAAGAAAGACGGCCAGACTAGGTCAAAAATGAGGCGAGGCTCGACACCGCAT
GGTGACTCGTCAGAGCTCAATGCGCTTGTTGACGCCAAGAAGCGAGAGGTAGACGCATACAAGAGGAGGAAAGCC
GAGGAAAGAAAAATGCTGCTTGCTGGCGAGGCTGCAGAGGGAGAGGAGGCATTGGAGAAGCCCGTCGCAGCCATG
GGTATTGACCCTCAGGCTGATGGCTCTCAAGCTGAGGAGCACAGCCAGGCGGAACCAGATGGCTCTCTAGCTGAG
GAGCTCAGTCAGGCGGAACCAGATGGCTCGGCAAATGAAGCTCGAGGGTCCTCGACGTCAAATGACACCATGGCA
TCGGCCACGACAGAGACGGATGCGAGACAAGAGATTGAGAGGCTCCAGGAATCAATCAAGGAAATCGACCAGGCA
GTTGATGCAGAGTTTGCCAAAGAAATGGAGAAAGTTCTGGATGAGAGCGATCGGGTAATAATGCCCAGCAATCTT
GAGCTCCTTGAGCATGGGCCAGGCGGCAGAAGCCAGCTTGACTCGGTTGAGATGCCTGATCTGGGCAAGGTGCCG
GGCGTCGAGGGTCTCTACAATAAGAGTGATGAGGAAAAGGATATAACACAGTCTTACAAGCAACTGCGACAGTTG
ACCGACATGGACATCAAGGATCTCAAGTCGCTCTACACCAAGAGCATTGTGACGCGCTATGTATCCAACCAGACG
CGTCTGGGAAAGGTGGAAAGCGCATCCGTGGTGGCCATTGCGGGCAACGGGAATGGGCTCTTGGGACTGGGTATA
GCAAAGTCGACGGATATTGGCGTGGCAATCGAGACGGCCAAGATGTTGGCGATTCGCAACATGAAGCCGATTCCG
CGCTACGAAAACCGCACCATTTTTGGCAATGTCAAGGTCAAGATATCGGGGACAATTGTTGAGATGTTTACCCGG
CCTCCTGGTGAGTGAGCCTCGTCTTCTTTTTCTCCCTCTTTTTCCTCCTCTTCTTCTTCCTCCCCCTCTTTTTCC
TCCTCCTCTTCTTCCTCCCCCTCTTCTTCCTCCCCCTCTTCTTCTTGTCGTCTCGTCGTGTTTTTGCCTCAAACA
CGTGCCAACTTGCCGGTTGCTATACAGGTTTTGGTCTCCGCTGTCCCGAACGCATCTTCGAAATGTGTCGCGCGG
CGGGACTGCATGACATGTCGGTGCGCATCCCTCGGTCGAGAAACGCCATGAACTCGGTCAAGGCTGCATATCAGG
CACTTTTGAAGCAGCCGGATCCTGAGGAGATTGCCCTGGGGCGCGGGCGGAAGCTGGTTGATGTGAGAAAAGTGT
ACTATGGCGGGTCGGTGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail