Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4757
Gene name
LocationContig_407:13075..13433
Strand+
Gene length (bp)358
Transcript length (bp)228
Coding sequence length (bp)228
Protein length (aa) 76

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14138 COX16 Cytochrome c oxidase assembly protein COX16 1.7E-26 1 68

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8P5|COX16_GIBZE Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX16 PE=3 SV=1 1 74 5.0E-39
sp|Q7SI11|COX16_NEUCR Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cox-9 PE=3 SV=1 1 74 3.0E-34
sp|Q0UIR3|COX16_PHANO Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=COX16 PE=3 SV=2 1 74 3.0E-29
sp|A1C8Z3|COX16_ASPCL Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cox16 PE=3 SV=2 1 74 5.0E-24
sp|Q5AXJ9|COX16_EMENI Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cox16 PE=3 SV=2 1 74 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8P5|COX16_GIBZE Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX16 PE=3 SV=1 1 74 5.0E-39
sp|Q7SI11|COX16_NEUCR Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cox-9 PE=3 SV=1 1 74 3.0E-34
sp|Q0UIR3|COX16_PHANO Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=COX16 PE=3 SV=2 1 74 3.0E-29
sp|A1C8Z3|COX16_ASPCL Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cox16 PE=3 SV=2 1 74 5.0E-24
sp|Q5AXJ9|COX16_EMENI Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cox16 PE=3 SV=2 1 74 3.0E-23
sp|Q2PIY2|COX16_ASPOR Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cox16 PE=3 SV=1 1 74 7.0E-23
sp|Q1DME3|COX16_COCIM Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Coccidioides immitis (strain RS) GN=COX16 PE=3 SV=1 1 74 8.0E-22
sp|Q52ZA1|COX16_PARBD Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=COX16 PE=2 SV=1 1 74 1.0E-21
sp|Q6FW43|COX16_CANGA Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=COX16 PE=3 SV=1 1 74 5.0E-15
sp|Q75FA7|COX16_ASHGO Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COX16 PE=3 SV=1 1 73 5.0E-15
sp|P47081|COX16_YEAST Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX16 PE=1 SV=1 1 73 3.0E-14
sp|Q6CK73|COX16_KLULA Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=COX16 PE=3 SV=1 1 73 2.0E-13
sp|Q6CCF6|COX16_YARLI Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX16 PE=3 SV=1 1 74 6.0E-13
sp|P0CM84|COX16_CRYNJ Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=COX16 PE=3 SV=1 1 65 7.0E-09
sp|P0CM85|COX16_CRYNB Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=COX16 PE=3 SV=1 1 65 7.0E-09
sp|Q9UTK1|COX16_SCHPO Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox16 PE=3 SV=1 7 69 3.0E-08
sp|Q6BY05|COX16_DEBHA Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COX16 PE=3 SV=1 1 50 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031966 mitochondrial membrane Yes
GO:0016020 membrane No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5745
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4757 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6661
Ophiocordyceps camponoti-floridani Ophcf2|04036
Ophiocordyceps camponoti-rufipedis Ophun1|1597
Ophiocordyceps kimflemingae Ophio5|7175
Ophiocordyceps subramaniannii Hirsu2|9165

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4757
MVAGSFVITPATAVRYERHDRRVRQMTREEELGVRRSARKVDMREEYYRLANRDLDNWEQKRVERLPGESDGILR
*
Coding >OphauG2|4757
ATGGTTGCAGGATCGTTTGTCATTACTCCAGCAACCGCAGTACGCTATGAGCGACACGACCGCAGGGTGCGGCAG
ATGACGAGGGAAGAGGAGCTGGGGGTGCGGCGGTCGGCACGCAAGGTCGACATGAGGGAGGAGTACTATCGATTG
GCGAACCGTGATCTTGACAACTGGGAGCAGAAGCGAGTGGAAAGGCTTCCGGGAGAGAGCGACGGAATCCTTCGC
TGA
Transcript >OphauG2|4757
ATGGTTGCAGGATCGTTTGTCATTACTCCAGCAACCGCAGTACGCTATGAGCGACACGACCGCAGGGTGCGGCAG
ATGACGAGGGAAGAGGAGCTGGGGGTGCGGCGGTCGGCACGCAAGGTCGACATGAGGGAGGAGTACTATCGATTG
GCGAACCGTGATCTTGACAACTGGGAGCAGAAGCGAGTGGAAAGGCTTCCGGGAGAGAGCGACGGAATCCTTCGC
TGA
Gene >OphauG2|4757
ATGGTTGCAGGATCGTTTGTCATTACTCCAGCAACCGCAGTACGCTATGAGCGACACGACCGCAGGGTGCGGCAG
ATGACGAGGGAAGAGGAGCTGGGGGTGCGGCGGTCGGCACGCAAGGTCGACATGAGGGAGGAGTACTATGTCAGT
GGCTATTTTCATCAGGCACGCGCGTCTACTTGTTTATTCACTTGACCATGTTTCTCCTGGGCCCCTGCTTCTTTT
TGTGGATGAAACCACTATATGACGTGTGGGACTCGCTGACGCTGAGCAGCGATTGGCGAACCGTGATCTTGACAA
CTGGGAGCAGAAGCGAGTGGAAAGGCTTCCGGGAGAGAGCGACGGAATCCTTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail