Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4745
Gene name
LocationContig_406:2466..4126
Strand+
Gene length (bp)1660
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00448 SRP54 SRP54-type protein, GTPase domain 4.1E-75 101 296
PF02978 SRP_SPB Signal peptide binding domain 3.1E-31 326 426
PF02881 SRP54_N SRP54-type protein, helical bundle domain 1.3E-20 6 83
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 1.7E-05 103 255
PF06414 Zeta_toxin Zeta toxin 5.6E-05 96 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00179|SRP54_ASPNG Signal recognition particle 54 kDa protein homolog OS=Aspergillus niger GN=srpA PE=3 SV=1 1 459 0.0E+00
sp|P21565|SRP54_SCHPO Signal recognition particle 54 kDa protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp54 PE=1 SV=1 1 462 0.0E+00
sp|Q99150|SRP54_YARLI Signal recognition particle 54 kDa protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRP54 PE=3 SV=2 1 443 0.0E+00
sp|P14576|SRP54_MOUSE Signal recognition particle 54 kDa protein OS=Mus musculus GN=Srp54 PE=1 SV=2 1 516 0.0E+00
sp|Q5R4R6|SRP54_PONAB Signal recognition particle 54 kDa protein OS=Pongo abelii GN=SRP54 PE=2 SV=1 1 516 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00179|SRP54_ASPNG Signal recognition particle 54 kDa protein homolog OS=Aspergillus niger GN=srpA PE=3 SV=1 1 459 0.0E+00
sp|P21565|SRP54_SCHPO Signal recognition particle 54 kDa protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp54 PE=1 SV=1 1 462 0.0E+00
sp|Q99150|SRP54_YARLI Signal recognition particle 54 kDa protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRP54 PE=3 SV=2 1 443 0.0E+00
sp|P14576|SRP54_MOUSE Signal recognition particle 54 kDa protein OS=Mus musculus GN=Srp54 PE=1 SV=2 1 516 0.0E+00
sp|Q5R4R6|SRP54_PONAB Signal recognition particle 54 kDa protein OS=Pongo abelii GN=SRP54 PE=2 SV=1 1 516 0.0E+00
sp|Q4R965|SRP54_MACFA Signal recognition particle 54 kDa protein OS=Macaca fascicularis GN=SRP54 PE=2 SV=1 1 516 0.0E+00
sp|P61011|SRP54_HUMAN Signal recognition particle 54 kDa protein OS=Homo sapiens GN=SRP54 PE=1 SV=1 1 516 0.0E+00
sp|P61010|SRP54_CANLF Signal recognition particle 54 kDa protein OS=Canis lupus familiaris GN=SRP54 PE=1 SV=1 1 516 0.0E+00
sp|Q2T9U1|SRP54_BOVIN Signal recognition particle 54 kDa protein OS=Bos taurus GN=SRP54 PE=2 SV=1 1 516 0.0E+00
sp|Q6AYB5|SRP54_RAT Signal recognition particle 54 kDa protein OS=Rattus norvegicus GN=Srp54 PE=2 SV=1 1 516 0.0E+00
sp|P20424|SRP54_YEAST Signal recognition particle subunit SRP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP54 PE=1 SV=2 1 428 0.0E+00
sp|O42816|SRP54_CANAX Signal recognition particle 54 kDa protein homolog OS=Candida albicans GN=SRP54 PE=2 SV=1 1 428 3.0E-180
sp|Q8MZJ6|SRP54_GEOCY Signal recognition particle 54 kDa protein OS=Geodia cydonium GN=SRP54 PE=2 SV=1 1 465 1.0E-176
sp|P49967|SR543_ARATH Signal recognition particle 54 kDa protein 3 OS=Arabidopsis thaliana GN=SRP-54C PE=2 SV=2 1 490 4.0E-156
sp|P49972|SR542_SOLLC Signal recognition particle 54 kDa protein 2 OS=Solanum lycopersicum PE=2 SV=1 1 467 2.0E-153
sp|P49969|SR542_HORVU Signal recognition particle 54 kDa protein 2 OS=Hordeum vulgare GN=SRP54-2 PE=2 SV=1 1 489 1.0E-151
sp|P49968|SR541_HORVU Signal recognition particle 54 kDa protein 1 OS=Hordeum vulgare GN=SRP54-1 PE=2 SV=1 1 489 2.0E-150
sp|P37106|SR541_ARATH Signal recognition particle 54 kDa protein 1 OS=Arabidopsis thaliana GN=SRP-54A PE=2 SV=1 1 466 1.0E-148
sp|P49971|SR541_SOLLC Signal recognition particle 54 kDa protein 1 OS=Solanum lycopersicum PE=3 SV=1 1 432 4.0E-148
sp|P49970|SR543_HORVU Signal recognition particle 54 kDa protein 3 OS=Hordeum vulgare GN=SRP54-3 PE=2 SV=1 1 500 6.0E-143
sp|Q75K18|SRP54_DICDI Signal recognition particle 54 kDa protein OS=Dictyostelium discoideum GN=srp54 PE=1 SV=1 1 467 8.0E-143
sp|P49966|SR542_ARATH Signal recognition particle 54 kDa protein 2 OS=Arabidopsis thaliana GN=SRP-54B PE=3 SV=2 1 499 1.0E-142
sp|O15821|SRP54_ENTHI Signal recognition particle 54 kDa protein OS=Entamoeba histolytica PE=3 SV=1 1 463 3.0E-137
sp|C5A233|SRP54_THEGJ Signal recognition particle 54 kDa protein OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=srp54 PE=3 SV=1 1 443 9.0E-116
sp|Q5JJC8|SRP54_THEKO Signal recognition particle 54 kDa protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=srp54 PE=3 SV=1 1 431 2.0E-112
sp|Q8U070|SRP54_PYRFU Signal recognition particle 54 kDa protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=srp54 PE=1 SV=1 1 445 2.0E-112
sp|B6YSS1|SRP54_THEON Signal recognition particle 54 kDa protein OS=Thermococcus onnurineus (strain NA1) GN=srp54 PE=3 SV=1 1 430 2.0E-112
sp|Q9V1E8|SRP54_PYRAB Signal recognition particle 54 kDa protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=srp54 PE=3 SV=1 1 431 2.0E-110
sp|O59307|SRP54_PYRHO Signal recognition particle 54 kDa protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=srp54 PE=3 SV=3 1 445 3.0E-110
sp|Q57565|SRP54_METJA Signal recognition particle 54 kDa protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=srp54 PE=1 SV=1 2 417 5.0E-104
sp|A6UWG4|SRP54_META3 Signal recognition particle 54 kDa protein OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=srp54 PE=3 SV=1 2 439 1.0E-99
sp|A6UQJ8|SRP54_METVS Signal recognition particle 54 kDa protein OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=srp54 PE=3 SV=1 2 435 2.0E-99
sp|A6VHE0|SRP54_METM7 Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=srp54 PE=3 SV=1 2 435 5.0E-99
sp|A0B638|SRP54_METTP Signal recognition particle 54 kDa protein OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=srp54 PE=3 SV=1 1 445 6.0E-99
sp|A9A9B0|SRP54_METM6 Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=srp54 PE=3 SV=1 2 435 2.0E-98
sp|Q971S9|SRP54_SULTO Signal recognition particle 54 kDa protein OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=srp54 PE=3 SV=2 25 428 3.0E-98
sp|A2BNB5|SRP54_HYPBU Signal recognition particle 54 kDa protein OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=srp54 PE=3 SV=1 10 430 4.0E-97
sp|Q0W2G1|SRP54_METAR Signal recognition particle 54 kDa protein OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=srp54 PE=3 SV=1 1 423 5.0E-96
sp|Q2NE47|SRP54_METST Signal recognition particle 54 kDa protein OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=srp54 PE=3 SV=1 23 439 2.0E-95
sp|O07853|SRP54_SULAC Signal recognition particle 54 kDa protein OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=srp54 PE=3 SV=2 25 428 3.0E-95
sp|Q12ZG8|SRP54_METBU Signal recognition particle 54 kDa protein OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=srp54 PE=3 SV=1 1 445 7.0E-95
sp|Q6LX03|SRP54_METMP Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain S2 / LL) GN=srp54 PE=3 SV=1 2 435 8.0E-94
sp|A2STI3|SRP54_METLZ Signal recognition particle 54 kDa protein OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=srp54 PE=3 SV=1 1 471 1.0E-93
sp|C3NDW4|SRP54_SULIY Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=srp54 PE=3 SV=1 25 428 5.0E-93
sp|C3NHT9|SRP54_SULIN Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=srp54 PE=3 SV=1 25 428 6.0E-93
sp|C3MPN4|SRP54_SULIL Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=srp54 PE=3 SV=1 25 428 7.0E-93
sp|Q46E01|SRP54_METBF Signal recognition particle 54 kDa protein OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=srp54 PE=3 SV=1 1 439 7.0E-93
sp|C3MYM8|SRP54_SULIM Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=srp54 PE=3 SV=1 25 428 7.0E-93
sp|C4KGX6|SRP54_SULIK Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=srp54 PE=3 SV=1 25 428 7.0E-93
sp|C3N5B0|SRP54_SULIA Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain M.16.27) GN=srp54 PE=3 SV=1 25 428 7.0E-93
sp|A4FVX4|SRP54_METM5 Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=srp54 PE=3 SV=1 2 435 7.0E-93
sp|A4YHL0|SRP54_METS5 Signal recognition particle 54 kDa protein OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=srp54 PE=3 SV=1 25 446 1.0E-92
sp|Q8THD0|SRP54_METAC Signal recognition particle 54 kDa protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=srp54 PE=3 SV=1 1 438 4.0E-92
sp|P70722|SRP54_ACIAM Signal recognition particle 54 kDa protein (Fragment) OS=Acidianus ambivalens GN=srp54 PE=1 SV=2 25 446 3.0E-91
sp|Q9YB62|SRP54_AERPE Signal recognition particle 54 kDa protein OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=srp54 PE=3 SV=1 10 439 2.0E-90
sp|A5UMY7|SRP54_METS3 Signal recognition particle 54 kDa protein OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=srp54 PE=3 SV=2 2 436 4.0E-90
sp|O27376|SRP54_METTH Signal recognition particle 54 kDa protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=srp54 PE=3 SV=1 2 439 5.0E-90
sp|Q18EV2|SRP54_HALWD Signal recognition particle 54 kDa protein OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=srp54 PE=3 SV=1 1 432 3.0E-89
sp|Q977V2|SRP54_HALVD Signal recognition particle 54 kDa protein OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=srp54 PE=1 SV=1 1 462 7.0E-89
sp|A3DML3|SRP54_STAMF Signal recognition particle 54 kDa protein OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=srp54 PE=3 SV=1 25 430 1.0E-88
sp|Q3IUP1|SRP54_NATPD Signal recognition particle 54 kDa protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=srp54 PE=3 SV=1 1 432 6.0E-88
sp|O29633|SRP54_ARCFU Signal recognition particle 54 kDa protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=srp54 PE=1 SV=1 3 421 3.0E-87
sp|Q97ZE7|SRP54_SULSO Signal recognition particle 54 kDa protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=srp54 PE=1 SV=1 25 407 4.0E-87
sp|Q8PXF3|SRP54_METMA Signal recognition particle 54 kDa protein OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=srp54 PE=3 SV=1 1 438 3.0E-86
sp|Q9HKT0|SRP54_THEAC Signal recognition particle 54 kDa protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=srp54 PE=3 SV=1 1 441 7.0E-86
sp|Q5UY20|SRP54_HALMA Signal recognition particle 54 kDa protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=srp54 PE=3 SV=1 1 432 1.0E-84
sp|B9LT33|SRP54_HALLT Signal recognition particle 54 kDa protein OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=srp54 PE=3 SV=1 1 432 3.0E-84
sp|A1RS43|SRP54_PYRIL Signal recognition particle 54 kDa protein OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=srp54 PE=3 SV=1 3 435 4.0E-82
sp|Q8TUY9|SRP54_METKA Signal recognition particle 54 kDa protein OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=srp54 PE=3 SV=1 23 439 7.0E-80
sp|B1Y9L4|SRP54_PYRNV Signal recognition particle 54 kDa protein OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=srp54 PE=3 SV=1 23 435 9.0E-79
sp|Q9HMN5|SRP54_HALSA Signal recognition particle 54 kDa protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=srp54 PE=3 SV=1 1 432 3.0E-78
sp|B0R7X3|SRP54_HALS3 Signal recognition particle 54 kDa protein OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=srp54 PE=3 SV=1 1 432 3.0E-78
sp|Q979Y8|SRP54_THEVO Signal recognition particle 54 kDa protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=srp54 PE=3 SV=1 1 433 8.0E-78
sp|A3MWX6|SRP54_PYRCJ Signal recognition particle 54 kDa protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=srp54 PE=3 SV=1 23 439 3.0E-77
sp|Q8ZT95|SRP54_PYRAE Signal recognition particle 54 kDa protein OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=srp54 PE=3 SV=1 23 435 3.0E-77
sp|A4WLQ3|SRP54_PYRAR Signal recognition particle 54 kDa protein OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=srp54 PE=3 SV=1 23 443 4.0E-75
sp|O67615|SRP54_AQUAE Signal recognition particle protein OS=Aquifex aeolicus (strain VF5) GN=ffh PE=3 SV=1 2 430 1.0E-64
sp|Q55311|SRP54_SYNE7 Signal recognition particle protein OS=Synechococcus elongatus (strain PCC 7942) GN=ffh PE=3 SV=1 6 412 3.0E-63
sp|Q54431|SRP54_STRMU Signal recognition particle protein OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ffh PE=3 SV=3 1 490 8.0E-63
sp|P37105|SRP54_BACSU Signal recognition particle protein OS=Bacillus subtilis (strain 168) GN=ffh PE=1 SV=1 1 430 1.0E-61
sp|P74214|SRP54_SYNY3 Signal recognition particle protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ffh PE=3 SV=1 6 418 2.0E-61
sp|P37107|SR54C_ARATH Signal recognition particle 54 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=FFC PE=1 SV=1 10 459 2.0E-60
sp|P9WGD7|SRP54_MYCTU Signal recognition particle protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ffh PE=1 SV=1 2 431 2.0E-59
sp|P9WGD6|SRP54_MYCTO Signal recognition particle protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ffh PE=3 SV=1 2 431 2.0E-59
sp|P66845|SRP54_MYCBO Signal recognition particle protein OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ffh PE=3 SV=1 2 431 2.0E-59
sp|O07347|SRP54_THEAQ Signal recognition particle protein OS=Thermus aquaticus GN=ffh PE=1 SV=3 2 439 3.0E-59
sp|O33013|SRP54_MYCLE Signal recognition particle protein OS=Mycobacterium leprae (strain TN) GN=ffh PE=3 SV=1 3 431 1.0E-56
sp|P44518|SRP54_HAEIN Signal recognition particle protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ffh PE=3 SV=1 2 428 6.0E-56
sp|P0AGD7|SRP54_ECOLI Signal recognition particle protein OS=Escherichia coli (strain K12) GN=ffh PE=1 SV=1 2 419 6.0E-55
sp|P0AGD8|SRP54_ECOL6 Signal recognition particle protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ffh PE=3 SV=1 2 419 6.0E-55
sp|P0AGD9|SRP54_ECO57 Signal recognition particle protein OS=Escherichia coli O157:H7 GN=ffh PE=3 SV=1 2 419 6.0E-55
sp|Q01442|SRP54_MYCMY Signal recognition particle protein OS=Mycoplasma mycoides GN=ffh PE=1 SV=1 6 418 2.0E-54
sp|Q92J55|SRP54_RICCN Signal recognition particle protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ffh PE=3 SV=1 23 440 5.0E-54
sp|Q4UKH4|SRP54_RICFE Signal recognition particle protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ffh PE=3 SV=2 23 439 2.0E-52
sp|Q1RHD6|SRP54_RICBR Signal recognition particle protein OS=Rickettsia bellii (strain RML369-C) GN=ffh PE=3 SV=1 23 440 3.0E-52
sp|P47294|SRP54_MYCGE Signal recognition particle protein OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ffh PE=3 SV=1 1 435 4.0E-51
sp|P75054|SRP54_MYCPN Signal recognition particle protein OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ffh PE=3 SV=1 1 435 5.0E-51
sp|P56005|SRP54_HELPY Signal recognition particle protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ffh PE=3 SV=1 24 430 5.0E-51
sp|Q9ZK62|SRP54_HELPJ Signal recognition particle protein OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ffh PE=3 SV=1 24 430 3.0E-50
sp|Q89AE4|SRP54_BUCBP Signal recognition particle protein OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ffh PE=3 SV=1 3 419 4.0E-50
sp|Q9ZDZ0|SRP54_RICPR Signal recognition particle protein OS=Rickettsia prowazekii (strain Madrid E) GN=ffh PE=3 SV=1 23 440 1.0E-48
sp|Q68XJ4|SRP54_RICTY Signal recognition particle protein OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ffh PE=3 SV=1 23 440 1.0E-45
sp|Q8K9F7|SRP54_BUCAP Signal recognition particle protein OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ffh PE=3 SV=1 3 417 8.0E-45
sp|P57473|SRP54_BUCAI Signal recognition particle protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ffh PE=3 SV=1 2 437 3.0E-44
sp|D4GYW6|FTSY_HALVD Signal recognition particle receptor FtsY OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=ftsY PE=3 SV=1 23 296 4.0E-37
sp|O67066|FTSY_AQUAE Signal recognition particle receptor FtsY OS=Aquifex aeolicus (strain VF5) GN=ftsY PE=3 SV=1 103 295 2.0E-36
sp|P51835|FTSY_BACSU Signal recognition particle receptor FtsY OS=Bacillus subtilis (strain 168) GN=ftsY PE=1 SV=2 38 296 5.0E-35
sp|P57137|FTSY_BUCAI Signal recognition particle receptor FtsY OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsY PE=3 SV=1 26 295 8.0E-35
sp|D3UJA7|FTSY_HELM1 Signal recognition particle receptor FtsY OS=Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) GN=ftsY PE=3 SV=1 31 295 1.0E-34
sp|P14929|FTSY_NEIGO Signal recognition particle receptor FtsY OS=Neisseria gonorrhoeae GN=ftsY PE=1 SV=2 29 295 2.0E-34
sp|O30391|FTSY_NEIMC Signal recognition particle receptor FtsY OS=Neisseria meningitidis serogroup C GN=ftsY PE=3 SV=1 29 295 2.0E-34
sp|P57010|FTSY_NEIMA Signal recognition particle receptor FtsY OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ftsY PE=3 SV=1 29 295 3.0E-34
sp|P57011|FTSY_NEIMB Signal recognition particle receptor FtsY OS=Neisseria meningitidis serogroup B (strain MC58) GN=ftsY PE=3 SV=1 29 295 3.0E-34
sp|Q92GB8|FTSY_RICCN Signal recognition particle receptor FtsY OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsY PE=3 SV=1 62 297 4.0E-34
sp|Q726P7|FTSY_DESVH Signal recognition particle receptor FtsY OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ftsY PE=3 SV=1 4 297 6.0E-34
sp|Q8TIN7|FTSY_METAC Signal recognition particle receptor FtsY OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ftsY PE=3 SV=1 6 296 6.0E-34
sp|P27414|FTSY_SULAC Signal recognition particle receptor FtsY OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ftsY PE=3 SV=1 23 296 6.0E-34
sp|Q68VX4|FTSY_RICTY Signal recognition particle receptor FtsY OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsY PE=3 SV=1 3 297 1.0E-33
sp|Q1RKK5|FTSY_RICBR Signal recognition particle receptor FtsY OS=Rickettsia bellii (strain RML369-C) GN=ftsY PE=3 SV=1 93 297 2.0E-33
sp|O80842|CFTSY_ARATH Cell division protein FtsY homolog, chloroplastic OS=Arabidopsis thaliana GN=CPFTSY PE=1 SV=2 22 295 2.0E-33
sp|Q57739|FTSY_METJA Signal recognition particle receptor FtsY OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ftsY PE=3 SV=1 43 296 1.0E-32
sp|Q8KA77|FTSY_BUCAP Signal recognition particle receptor FtsY OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsY PE=3 SV=1 23 295 2.0E-32
sp|P44870|FTSY_HAEIN Signal recognition particle receptor FtsY OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsY PE=3 SV=1 42 295 4.0E-32
sp|P83749|FTSY_THEAQ Signal recognition particle receptor FtsY OS=Thermus aquaticus GN=ftsY PE=1 SV=2 75 295 4.0E-32
sp|Q4UK46|FTSY_RICFE Signal recognition particle receptor FtsY OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsY PE=3 SV=1 55 297 1.0E-31
sp|O05948|FTSY_RICPR Signal recognition particle receptor FtsY OS=Rickettsia prowazekii (strain Madrid E) GN=ftsY PE=3 SV=1 40 297 3.0E-31
sp|A9CHH2|FTSY_AGRFC Signal recognition particle receptor FtsY OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ftsY PE=3 SV=1 82 297 4.0E-31
sp|Q8CWX8|FTSY_STRMU Signal recognition particle receptor FtsY OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ftsY PE=3 SV=1 39 295 9.0E-31
sp|Q9HJ93|FTSY_THEAC Signal recognition particle receptor FtsY OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=ftsY PE=3 SV=1 100 295 2.0E-30
sp|P10121|FTSY_ECOLI Signal recognition particle receptor FtsY OS=Escherichia coli (strain K12) GN=ftsY PE=1 SV=1 92 299 3.0E-30
sp|O32861|FTSY_MYCHP Signal recognition particle receptor FtsY OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=ftsY PE=3 SV=1 39 291 3.0E-30
sp|P47539|FTSY_MYCGE Signal recognition particle receptor FtsY OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsY PE=3 SV=1 19 291 2.0E-29
sp|Q89B28|FTSY_BUCBP Signal recognition particle receptor FtsY OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsY PE=3 SV=1 29 296 5.0E-29
sp|P73930|FTSY_SYNY3 Signal recognition particle receptor FtsY OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsY PE=3 SV=1 32 296 8.0E-29
sp|Q8G736|FTSY_BIFLO Signal recognition particle receptor FtsY OS=Bifidobacterium longum (strain NCC 2705) GN=ftsY PE=3 SV=1 7 296 9.0E-29
sp|Q9RS67|FTSY_DEIRA Signal recognition particle receptor FtsY OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ftsY PE=3 SV=1 28 295 9.0E-28
sp|Q6MTB9|FTSY_MYCMS Signal recognition particle receptor FtsY OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ftsY PE=1 SV=1 25 294 1.0E-27
sp|P75362|FTSY_MYCPN Signal recognition particle receptor FtsY OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsY PE=3 SV=1 69 291 3.0E-27
sp|P9WGD9|FTSY_MYCTU Signal recognition particle receptor FtsY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsY PE=1 SV=1 24 296 2.0E-26
sp|P9WGD8|FTSY_MYCTO Signal recognition particle receptor FtsY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsY PE=3 SV=1 24 296 2.0E-26
sp|P66843|FTSY_MYCBO Signal recognition particle receptor FtsY OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsY PE=3 SV=1 24 296 2.0E-26
sp|Q9Z6T7|FTSY_CHLPN Signal recognition particle receptor FtsY OS=Chlamydia pneumoniae GN=ftsY PE=3 SV=1 100 295 6.0E-25
sp|O43032|SRPR_SCHPO Signal recognition particle receptor subunit alpha homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp101 PE=3 SV=1 23 295 3.0E-24
sp|O33010|FTSY_MYCLE Signal recognition particle receptor FtsY OS=Mycobacterium leprae (strain TN) GN=ftsY PE=3 SV=1 96 295 9.0E-24
sp|O25458|FTSY_HELPY Signal recognition particle receptor FtsY OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsY PE=3 SV=1 33 295 1.0E-23
sp|Q9ZL80|FTSY_HELPJ Signal recognition particle receptor FtsY OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsY PE=3 SV=1 33 295 3.0E-23
sp|P08240|SRPR_HUMAN Signal recognition particle receptor subunit alpha OS=Homo sapiens GN=SRPR PE=1 SV=2 25 295 7.0E-21
sp|Q9DBG7|SRPR_MOUSE Signal recognition particle receptor subunit alpha OS=Mus musculus GN=Srpr PE=1 SV=1 25 295 7.0E-21
sp|Q3MHE8|SRPR_BOVIN Signal recognition particle receptor subunit alpha OS=Bos taurus GN=SRPR PE=2 SV=1 16 295 2.0E-20
sp|Q54ZR7|SRPR_DICDI Signal recognition particle receptor subunit alpha OS=Dictyostelium discoideum GN=srpr PE=3 SV=1 23 295 5.0E-20
sp|P06625|SRPR_CANLF Signal recognition particle receptor subunit alpha OS=Canis lupus familiaris GN=SRPR PE=2 SV=2 25 295 9.0E-20
sp|Q9U5L1|SRPR_DROME Signal recognition particle receptor subunit alpha homolog OS=Drosophila melanogaster GN=Gtp-bp PE=1 SV=2 39 295 5.0E-18
sp|P32916|SRPR_YEAST Signal recognition particle receptor subunit alpha homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP101 PE=1 SV=2 98 296 2.0E-15
sp|Q56339|FLHF_TREPA Flagellar biosynthesis protein FlhF OS=Treponema pallidum (strain Nichols) GN=flhF PE=3 SV=1 75 301 6.0E-13
sp|O67266|FLHF_AQUAE Flagellar biosynthesis protein FlhF OS=Aquifex aeolicus (strain VF5) GN=flhF PE=3 SV=1 101 279 2.0E-11
sp|O52256|FLHF_PSEPU Flagellar biosynthesis protein FlhF OS=Pseudomonas putida GN=flhF PE=3 SV=1 59 281 3.0E-10
sp|O52908|FLHF_CAMJE Flagellar biosynthesis protein FlhF OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=flhF PE=3 SV=2 48 281 4.0E-09
sp|Q44758|FLHF_BORBU Flagellar biosynthesis protein FlhF OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=flhF PE=3 SV=1 100 309 3.0E-07
sp|Q9I3P8|FLHF_PSEAE Flagellar biosynthesis protein FlhF OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=flhF PE=3 SV=1 68 281 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0048500 signal recognition particle Yes
GO:0005525 GTP binding Yes
GO:0005524 ATP binding Yes
GO:0016301 kinase activity Yes
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0008312 7S RNA binding Yes
GO:0015031 protein transport No
GO:0017076 purine nucleotide binding No
GO:0071705 nitrogen compound transport No
GO:0006605 protein targeting No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0045047 protein targeting to ER No
GO:1901265 nucleoside phosphate binding No
GO:0071702 organic substance transport No
GO:0051234 establishment of localization No
GO:0032553 ribonucleotide binding No
GO:0032991 protein-containing complex No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006612 protein targeting to membrane No
GO:0051668 localization within membrane No
GO:0006886 intracellular protein transport No
GO:0032561 guanyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0051179 localization No
GO:0043168 anion binding No
GO:0070727 cellular macromolecule localization No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0043167 ion binding No
GO:0003676 nucleic acid binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0006613 cotranslational protein targeting to membrane No
GO:0008104 protein localization No
GO:0019001 guanyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0006810 transport No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003723 RNA binding No
GO:1990904 ribonucleoprotein complex No
GO:0097159 organic cyclic compound binding No
GO:0072657 protein localization to membrane No
GO:0033036 macromolecule localization No
GO:0033365 protein localization to organelle No
GO:0072594 establishment of protein localization to organelle No
GO:0016740 transferase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0046907 intracellular transport No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0090150 establishment of protein localization to membrane No
GO:0051649 establishment of localization in cell No
GO:0045184 establishment of protein localization No
GO:0051641 cellular localization No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0072599 establishment of protein localization to endoplasmic reticulum No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3845
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4745 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4064
Ophiocordyceps camponoti-floridani Ophcf2|01615
Ophiocordyceps camponoti-rufipedis Ophun1|2395
Ophiocordyceps kimflemingae Ophio5|3106
Ophiocordyceps subramaniannii Hirsu2|7575

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4745
MVLQDLGRRINAAVTNITREPNLDEKALDNMLKEICAALLEADVNVRLVGQLRKSIKAAVNLKELPPAVNKKRLV
QKAVFDELVRLVDPQTEPFRPRKGKPNVIMFVGLQGAGKTTTCTKLARHYQSRGLRSCLVCADTFRAGAFDQLKQ
NATKAKIPYYGSLTETDPAVVARAGVDQFKREKFDVIIVDTSGRHRQEAALFQEMVDIQTAISPDETIMVLDASI
GQQAEAQAKAFKEAADFGAIIITKADGHAHGGGAISAVAATRTPIVFIGTGEHMLDLERFAPQPFVQKLLGMGDM
AGLVEHVQSLNLDQKETIKHIQEGIFTVRDLRDQLSNIIKMGPLSKMAGMIPGMSGMMQGMDDEEGGAKLRRMIY
MCDSMTEKELDSDGKMLVEQPTRMTRIARGSGTSVREVEDLLTQQRMMAGMAKKMGGNLKNMQRAQQAMGGGNKA
QQMAAMQKRLQSMGGAGAGGPGGGGGMPDMGALMRMLGGGGGAGGGGGGMPDMQALMRQMGMSGAGPGGGGRGGG
GRGRR*
Coding >OphauG2|4745
ATGGTGCTCCAAGACCTGGGCCGCCGCATCAACGCGGCCGTGACGAACATCACGCGAGAGCCTAATCTCGACGAA
AAGGCTCTCGACAACATGCTCAAGGAAATATGCGCTGCCCTGCTAGAAGCCGACGTCAATGTACGCCTCGTTGGC
CAGCTGCGCAAGTCCATCAAGGCGGCCGTCAACCTCAAAGAGCTCCCCCCCGCCGTCAACAAGAAGCGCCTGGTG
CAAAAGGCCGTTTTCGACGAGCTGGTGCGCCTTGTTGATCCCCAGACAGAGCCGTTTCGGCCGCGCAAGGGCAAG
CCCAACGTCATCATGTTTGTCGGTCTGCAAGGCGCCGGCAAGACGACTACTTGCACCAAGCTGGCTCGCCACTAC
CAGAGCCGCGGACTGCGCTCCTGTCTGGTGTGCGCCGACACTTTTCGCGCCGGAGCCTTTGACCAGCTCAAGCAA
AACGCCACCAAGGCCAAGATTCCCTACTACGGCTCGCTGACCGAGACTGACCCTGCTGTCGTTGCACGCGCCGGC
GTCGACCAGTTTAAGCGGGAAAAGTTTGATGTCATTATTGTGGATACATCGGGCCGCCACAGGCAAGAGGCCGCT
CTCTTCCAAGAAATGGTGGACATTCAGACGGCCATTAGCCCCGACGAGACCATCATGGTGCTGGATGCCTCGATT
GGCCAGCAGGCCGAGGCGCAGGCCAAGGCGTTCAAGGAGGCGGCCGACTTTGGCGCCATCATCATCACAAAGGCC
GACGGCCACGCACACGGCGGCGGCGCCATTTCTGCCGTGGCAGCAACGCGCACGCCCATTGTCTTTATCGGCACG
GGCGAGCACATGCTGGACCTAGAGCGCTTTGCCCCCCAGCCCTTTGTACAGAAGCTGCTGGGCATGGGCGACATG
GCGGGCCTGGTGGAACACGTGCAGAGCCTCAACCTGGACCAAAAGGAGACGATTAAACACATCCAAGAGGGCATC
TTCACAGTGCGCGACCTGCGCGACCAGCTGTCCAACATCATCAAGATGGGCCCGCTGTCCAAGATGGCGGGCATG
ATTCCCGGCATGAGCGGCATGATGCAGGGCATGGACGACGAGGAAGGCGGCGCCAAGCTGCGGCGCATGATTTAC
ATGTGCGACTCCATGACGGAAAAGGAGCTCGACTCGGACGGCAAGATGCTGGTGGAGCAACCGACGCGCATGACG
CGCATAGCTCGCGGCTCTGGCACGTCGGTGCGCGAGGTGGAAGACTTGCTGACGCAACAACGCATGATGGCAGGC
ATGGCCAAGAAGATGGGCGGCAACCTGAAGAACATGCAGCGCGCCCAGCAGGCCATGGGCGGCGGCAACAAGGCC
CAGCAAATGGCGGCCATGCAGAAGCGCCTGCAGAGCATGGGCGGCGCGGGGGCGGGAGGCCCTGGAGGAGGCGGC
GGCATGCCAGACATGGGTGCTCTGATGCGCATGCTGGGCGGTGGAGGAGGAGCTGGAGGAGGCGGAGGTGGCATG
CCAGACATGCAGGCTCTGATGCGGCAGATGGGCATGTCTGGGGCAGGGCCTGGCGGAGGCGGTAGGGGGGGAGGC
GGGAGAGGGAGGCGGTAG
Transcript >OphauG2|4745
ATGGTGCTCCAAGACCTGGGCCGCCGCATCAACGCGGCCGTGACGAACATCACGCGAGAGCCTAATCTCGACGAA
AAGGCTCTCGACAACATGCTCAAGGAAATATGCGCTGCCCTGCTAGAAGCCGACGTCAATGTACGCCTCGTTGGC
CAGCTGCGCAAGTCCATCAAGGCGGCCGTCAACCTCAAAGAGCTCCCCCCCGCCGTCAACAAGAAGCGCCTGGTG
CAAAAGGCCGTTTTCGACGAGCTGGTGCGCCTTGTTGATCCCCAGACAGAGCCGTTTCGGCCGCGCAAGGGCAAG
CCCAACGTCATCATGTTTGTCGGTCTGCAAGGCGCCGGCAAGACGACTACTTGCACCAAGCTGGCTCGCCACTAC
CAGAGCCGCGGACTGCGCTCCTGTCTGGTGTGCGCCGACACTTTTCGCGCCGGAGCCTTTGACCAGCTCAAGCAA
AACGCCACCAAGGCCAAGATTCCCTACTACGGCTCGCTGACCGAGACTGACCCTGCTGTCGTTGCACGCGCCGGC
GTCGACCAGTTTAAGCGGGAAAAGTTTGATGTCATTATTGTGGATACATCGGGCCGCCACAGGCAAGAGGCCGCT
CTCTTCCAAGAAATGGTGGACATTCAGACGGCCATTAGCCCCGACGAGACCATCATGGTGCTGGATGCCTCGATT
GGCCAGCAGGCCGAGGCGCAGGCCAAGGCGTTCAAGGAGGCGGCCGACTTTGGCGCCATCATCATCACAAAGGCC
GACGGCCACGCACACGGCGGCGGCGCCATTTCTGCCGTGGCAGCAACGCGCACGCCCATTGTCTTTATCGGCACG
GGCGAGCACATGCTGGACCTAGAGCGCTTTGCCCCCCAGCCCTTTGTACAGAAGCTGCTGGGCATGGGCGACATG
GCGGGCCTGGTGGAACACGTGCAGAGCCTCAACCTGGACCAAAAGGAGACGATTAAACACATCCAAGAGGGCATC
TTCACAGTGCGCGACCTGCGCGACCAGCTGTCCAACATCATCAAGATGGGCCCGCTGTCCAAGATGGCGGGCATG
ATTCCCGGCATGAGCGGCATGATGCAGGGCATGGACGACGAGGAAGGCGGCGCCAAGCTGCGGCGCATGATTTAC
ATGTGCGACTCCATGACGGAAAAGGAGCTCGACTCGGACGGCAAGATGCTGGTGGAGCAACCGACGCGCATGACG
CGCATAGCTCGCGGCTCTGGCACGTCGGTGCGCGAGGTGGAAGACTTGCTGACGCAACAACGCATGATGGCAGGC
ATGGCCAAGAAGATGGGCGGCAACCTGAAGAACATGCAGCGCGCCCAGCAGGCCATGGGCGGCGGCAACAAGGCC
CAGCAAATGGCGGCCATGCAGAAGCGCCTGCAGAGCATGGGCGGCGCGGGGGCGGGAGGCCCTGGAGGAGGCGGC
GGCATGCCAGACATGGGTGCTCTGATGCGCATGCTGGGCGGTGGAGGAGGAGCTGGAGGAGGCGGAGGTGGCATG
CCAGACATGCAGGCTCTGATGCGGCAGATGGGCATGTCTGGGGCAGGGCCTGGCGGAGGCGGTAGGGGGGGAGGC
GGGAGAGGGAGGCGGTAG
Gene >OphauG2|4745
ATGGTGCTCCAAGACCTGGGCCGCCGCATCAACGCGGCCGTGACGAACATCACGCGAGAGCCTAATCTCGACGAA
AAGGTAAAAAGAAGCCATGACCAAGCCCAATGCTTGCAGCTTTTGCCGCTAACCATGGAGACGACTACAGGCTCT
CGACAACATGCTCAAGGAAATATGCGCTGCCCTGCTAGAAGCCGACGTCAATGTACGCCTCGTTGGCCAGCTGCG
CAAGTCCATCAAGGCGGCCGTCAACCTCAAAGAGCTCCCCCCCGCCGTCAACAAGAAGCGCCTGGTGCAAAAGGC
CGTTTTCGACGAGCTGGTGCGCCTTGTTGATCCCCAGACAGAGCCGTTTCGGCCGCGCAAGGGCAAGCCCAACGT
CATCATGTTTGTCGGTCTGCAAGGCGCCGGCAAGACGACTACTTGCACCAAGCTGGCTCGCCACTACCAGAGCCG
CGGACTGCGCTCCTGTCTGGTGTGCGCCGACACTTTTCGCGCCGGAGCCTTTGACCAGCTCAAGCAAAACGCCAC
CAAGGCCAAGATTCCCTACTACGGCTCGCTGACCGAGACTGACCCTGCTGTCGTTGCACGCGCCGGCGTCGACCA
GTTTAAGCGGGAAAAGTTTGATGTCATTATTGTGGATACATCGGGCCGCCACAGGCAAGAGGCCGCTCTCTTCCA
AGAAATGGTGGACATTCAGACGGCCATTAGCCCCGACGAGACCATCATGGTGCTGGATGCCTCGATTGGCCAGCA
GGCCGAGGCGCAGGCCAAGGCGTTCAAGGAGGCGGCCGACTTTGGCGCCATCATCATCACAAAGGCCGACGGCCA
CGCACACGGCGGCGGCGCCATTTCTGCCGTGGCAGCAACGCGCACGCCCATTGTCTTTATCGGCACGGGCGAGCA
CATGCTGGACCTAGAGCGCTTTGCCCCCCAGCCCTTTGTACAGAAGCTGCTGGGCATGGGCGACATGGCGGGCCT
GGTGGAACACGTGCAGAGCCTCAACCTGGACCAAAAGGAGACGATTAAACACATCCAAGAGGGCATCTTCACAGT
GCGCGACCTGCGCGACCAGCTGTCCAACATCATCAAGATGGGCCCGCTGTCCAAGATGGCGGGCATGATTCCCGG
CATGAGCGGCATGATGCAGGGCATGGACGACGAGGAAGGCGGCGCCAAGCTGCGGCGCATGATTTACATGTGCGA
CTCCATGACGGAAAAGGAGCTCGACTCGGACGGCAAGATGCTGGTGGAGCAACCGACGCGCATGACGCGCATAGC
TCGCGGCTCTGGCACGTCGGTGCGCGAGGTGGAAGACTTGCTGACGCAACAACGCATGATGGCAGGCATGGCCAA
GAAGATGGGCGGCAACCTGAAGAACATGCAGCGCGCCCAGCAGGCCATGGGCGGCGGCAACAAGGCCCAGCAAAT
GGCGGCCATGCAGAAGCGCCTGCAGAGCATGGGCGGCGCGGGGGCGGGAGGCCCTGGAGGAGGCGGCGGCATGCC
AGACATGGGTGCTCTGATGCGCATGCTGGGCGGTGGAGGAGGAGCTGGAGGAGGCGGAGGTGGCATGCCAGACAT
GCAGGCTCTGATGCGGCAGATGGGCATGTCTGGGGCAGGGCCTGGCGGAGGCGGTAGGGGGGGAGGCGGGAGAGG
GAGGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail