Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4742
Gene name
LocationContig_405:13149..14106
Strand+
Gene length (bp)957
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 7.5E-16 230 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 150 299 9.0E-30
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 150 299 2.0E-29
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 193 299 2.0E-29
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 193 299 2.0E-29
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 183 305 5.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 150 299 9.0E-30
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 150 299 2.0E-29
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 193 299 2.0E-29
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 193 299 2.0E-29
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 183 305 5.0E-29
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 193 299 7.0E-29
sp|Q9LXD1|RLF_ARATH Cytochrome b5 domain-containing protein RLF OS=Arabidopsis thaliana GN=RLF PE=2 SV=1 182 303 4.0E-27
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 187 302 7.0E-18
sp|Q04772|IRC21_YEAST Increased recombination centers protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC21 PE=1 SV=1 225 303 6.0E-13
sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 198 302 2.0E-11
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 229 299 3.0E-09
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 225 285 1.0E-07
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 232 299 2.0E-07
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 242 283 3.0E-07
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 232 299 3.0E-07
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 232 299 8.0E-07
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 232 299 8.0E-07
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 232 283 1.0E-06
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 230 299 2.0E-06
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 232 299 2.0E-06
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 209 283 3.0E-06
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 234 285 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4742
MGVLGLSLLFASVAFYFHRHPAYRPTVLLQWIGLGSLVPDSARPQEKSGHDETSSSSHSPGDTTTISLQTPSPPT
SSHGPDSPTTPKASAVDAPSPEPVPTLQLSDPADRQQAAPTPGPASMMPPPPLPLASKSSKPSPQPYAIPTLPQF
PAANSVQRASAAPRGPIPNRIPLSSGLVPPSTRSTPPERPSRKITLKPGRSPLDWARISGPNADLRGLPPETPYL
RIPPSLLQKHNGRKGADAWMVLNSRVYNVSPYADYHPGGIPELMRGAGRDGTKLFGDIHPWVNYESMLSACMVGL
FVDEPLNGDAINEMDEMD*
Coding >OphauG2|4742
ATGGGCGTCTTGGGGCTGTCGCTGCTCTTCGCTTCCGTTGCCTTTTATTTCCACCGCCATCCAGCCTACCGTCCG
ACTGTGCTCCTGCAATGGATTGGCCTGGGGTCCCTCGTCCCGGATTCAGCCCGACCCCAAGAAAAAAGTGGTCAT
GATGAGACGTCGTCGTCATCCCATAGCCCTGGCGACACAACCACCATTTCTCTCCAGACTCCTTCGCCCCCCACA
AGCAGCCATGGCCCCGATAGTCCGACAACACCAAAGGCATCGGCCGTCGACGCGCCCTCTCCGGAGCCAGTGCCC
ACGTTGCAGCTCTCCGACCCGGCTGACCGACAACAAGCCGCTCCGACCCCTGGCCCCGCCTCAATGATGCCACCG
CCTCCTCTTCCTCTCGCATCCAAATCTAGCAAACCTTCTCCTCAGCCCTACGCCATCCCGACCCTCCCACAGTTT
CCTGCCGCCAATTCGGTGCAGCGCGCCTCGGCTGCTCCCCGTGGGCCTATACCCAACCGTATCCCGCTTTCATCC
GGCCTTGTGCCTCCGTCAACTCGGTCAACTCCCCCCGAGCGCCCCAGTCGCAAAATCACGCTCAAGCCTGGCCGC
TCGCCACTCGACTGGGCGCGTATATCAGGCCCCAACGCTGATCTCCGTGGCCTCCCTCCCGAGACGCCCTATCTG
CGCATTCCACCCTCACTTCTCCAAAAACATAATGGGCGCAAAGGCGCTGACGCCTGGATGGTCCTCAACAGTAGA
GTCTACAACGTCTCACCTTATGCCGACTACCATCCTGGCGGCATCCCCGAGCTTATGCGTGGCGCTGGCCGCGAC
GGCACCAAGCTCTTTGGCGACATTCATCCCTGGGTCAACTACGAGTCCATGTTATCCGCATGCATGGTAGGTCTT
TTCGTTGACGAGCCCTTGAATGGCGATGCAATAAACGAAATGGACGAAATGGACTAG
Transcript >OphauG2|4742
ATGGGCGTCTTGGGGCTGTCGCTGCTCTTCGCTTCCGTTGCCTTTTATTTCCACCGCCATCCAGCCTACCGTCCG
ACTGTGCTCCTGCAATGGATTGGCCTGGGGTCCCTCGTCCCGGATTCAGCCCGACCCCAAGAAAAAAGTGGTCAT
GATGAGACGTCGTCGTCATCCCATAGCCCTGGCGACACAACCACCATTTCTCTCCAGACTCCTTCGCCCCCCACA
AGCAGCCATGGCCCCGATAGTCCGACAACACCAAAGGCATCGGCCGTCGACGCGCCCTCTCCGGAGCCAGTGCCC
ACGTTGCAGCTCTCCGACCCGGCTGACCGACAACAAGCCGCTCCGACCCCTGGCCCCGCCTCAATGATGCCACCG
CCTCCTCTTCCTCTCGCATCCAAATCTAGCAAACCTTCTCCTCAGCCCTACGCCATCCCGACCCTCCCACAGTTT
CCTGCCGCCAATTCGGTGCAGCGCGCCTCGGCTGCTCCCCGTGGGCCTATACCCAACCGTATCCCGCTTTCATCC
GGCCTTGTGCCTCCGTCAACTCGGTCAACTCCCCCCGAGCGCCCCAGTCGCAAAATCACGCTCAAGCCTGGCCGC
TCGCCACTCGACTGGGCGCGTATATCAGGCCCCAACGCTGATCTCCGTGGCCTCCCTCCCGAGACGCCCTATCTG
CGCATTCCACCCTCACTTCTCCAAAAACATAATGGGCGCAAAGGCGCTGACGCCTGGATGGTCCTCAACAGTAGA
GTCTACAACGTCTCACCTTATGCCGACTACCATCCTGGCGGCATCCCCGAGCTTATGCGTGGCGCTGGCCGCGAC
GGCACCAAGCTCTTTGGCGACATTCATCCCTGGGTCAACTACGAGTCCATGTTATCCGCATGCATGGTAGGTCTT
TTCGTTGACGAGCCCTTGAATGGCGATGCAATAAACGAAATGGACGAAATGGACTAG
Gene >OphauG2|4742
ATGGGCGTCTTGGGGCTGTCGCTGCTCTTCGCTTCCGTTGCCTTTTATTTCCACCGCCATCCAGCCTACCGTCCG
ACTGTGCTCCTGCAATGGATTGGCCTGGGGTCCCTCGTCCCGGATTCAGCCCGACCCCAAGAAAAAAGTGGTCAT
GATGAGACGTCGTCGTCATCCCATAGCCCTGGCGACACAACCACCATTTCTCTCCAGACTCCTTCGCCCCCCACA
AGCAGCCATGGCCCCGATAGTCCGACAACACCAAAGGCATCGGCCGTCGACGCGCCCTCTCCGGAGCCAGTGCCC
ACGTTGCAGCTCTCCGACCCGGCTGACCGACAACAAGCCGCTCCGACCCCTGGCCCCGCCTCAATGATGCCACCG
CCTCCTCTTCCTCTCGCATCCAAATCTAGCAAACCTTCTCCTCAGCCCTACGCCATCCCGACCCTCCCACAGTTT
CCTGCCGCCAATTCGGTGCAGCGCGCCTCGGCTGCTCCCCGTGGGCCTATACCCAACCGTATCCCGCTTTCATCC
GGCCTTGTGCCTCCGTCAACTCGGTCAACTCCCCCCGAGCGCCCCAGTCGCAAAATCACGCTCAAGCCTGGCCGC
TCGCCACTCGACTGGGCGCGTATATCAGGCCCCAACGCTGATCTCCGTGGCCTCCCTCCCGAGACGCCCTATCTG
CGCATTCCACCCTCACTTCTCCAAAAACATAATGGGCGCAAAGGCGCTGACGCCTGGATGGTCCTCAACAGTAGA
GTCTACAACGTCTCACCTTATGCCGACTACCATCCTGGCGGCATCCCCGAGCTTATGCGTGGCGCTGGCCGCGAC
GGCACCAAGCTCTTTGGCGACATTCATCCCTGGGTCAACTACGAGTCCATGTTATCCGCATGCATGGTAGGTCTT
TTCGTTGACGAGCCCTTGAATGGCGATGCAATAAACGAAATGGACGAAATGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail