Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4730
Gene name
LocationContig_403:7225..8230
Strand+
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 2.0E-04 146 168
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 8.6E-04 180 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A1L3L1|PTR1B_XENLA Protein prenyltransferase alpha subunit repeat-containing protein 1-B (Fragment) OS=Xenopus laevis GN=ptar1-b PE=2 SV=1 77 252 4.0E-10
sp|Q02202|ECM9_YEAST Protein ECM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM9 PE=1 SV=2 93 272 2.0E-08
sp|Q0IHB3|PTR1A_XENLA Protein prenyltransferase alpha subunit repeat-containing protein 1-A OS=Xenopus laevis GN=ptar1-a PE=2 SV=1 76 249 2.0E-08
sp|A3KPW7|PTAR1_DANRE Protein prenyltransferase alpha subunit repeat-containing protein 1 OS=Danio rerio GN=ptar1 PE=2 SV=1 92 252 8.0E-07

GO

GO Term Description Terminal node
GO:0008318 protein prenyltransferase activity Yes
GO:0018342 protein prenylation Yes
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0097354 prenylation No
GO:0008152 metabolic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0004659 prenyltransferase activity No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4792
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4730 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6282
Ophiocordyceps camponoti-floridani Ophcf2|04351
Ophiocordyceps camponoti-rufipedis Ophun1|3030
Ophiocordyceps kimflemingae Ophio5|6059
Ophiocordyceps subramaniannii Hirsu2|10256

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4730
MSRALDKGIQEALEQADLEIPFKHISTALSQIRDALLDIELLGSSHASIDATLLQDGNAIAIPKRRLVEAFICAR
KRFISFQQSKELQNTRKQHVLSVTAVMLLMDPEHLTAANARKQVLSEALEMCPSDVAPLLNEKFLIDSLLTSHLH
RHTKSPTLWSHRRWLMRRISAMGAANNIVEELASVVFVSAERHPRNYYAWGHARLLVESTVAHSGKPEAELDIKR
MVQDTKKWCFNHHDDVSGWMFLAFLLEKWPSCTASVLRETLQLVQSFRWRNESVWHFLRNVVSMQSQAAGLSVNQ
VRTVCNALLKDAADGDQKVLNDALKWLEKYTEFE*
Coding >OphauG2|4730
ATGTCACGGGCTCTCGACAAGGGCATTCAAGAGGCACTCGAGCAGGCCGACCTTGAAATTCCATTTAAGCACATA
TCCACAGCTTTATCACAGATTCGTGACGCCTTGCTCGACATTGAACTGTTGGGATCAAGCCACGCTTCGATTGAC
GCAACTCTACTCCAGGATGGCAATGCCATAGCAATCCCCAAGCGGCGCCTTGTGGAGGCTTTTATATGTGCACGG
AAAAGATTCATTTCCTTTCAGCAAAGCAAAGAGCTTCAAAACACGCGTAAACAACATGTGCTCTCTGTGACGGCC
GTCATGCTGCTTATGGATCCTGAGCATCTGACTGCGGCAAATGCGCGCAAACAAGTGCTCTCAGAGGCTTTGGAG
ATGTGTCCAAGTGACGTAGCACCTCTGTTGAATGAAAAGTTTTTGATAGACAGTCTTCTCACAAGTCACCTTCAT
CGACACACAAAGTCGCCGACCCTCTGGAGTCACCGGCGATGGCTGATGAGGAGAATCAGTGCCATGGGAGCAGCA
AACAATATCGTTGAGGAACTGGCAAGCGTTGTCTTCGTCTCAGCCGAGAGACATCCGCGAAATTACTATGCATGG
GGCCATGCTAGGCTCCTTGTCGAGTCTACCGTCGCCCACAGCGGCAAACCTGAAGCCGAGCTGGATATAAAAAGA
ATGGTACAAGACACCAAGAAATGGTGCTTCAACCACCACGATGATGTTTCTGGCTGGATGTTTTTAGCTTTTCTC
CTTGAGAAATGGCCCTCTTGCACCGCGTCTGTCTTGCGAGAAACGTTGCAGCTTGTCCAATCGTTTCGATGGCGC
AACGAATCAGTATGGCATTTTCTTCGCAATGTGGTGTCAATGCAATCTCAGGCAGCAGGGCTGTCAGTGAATCAA
GTTCGAACCGTCTGTAATGCTCTCCTCAAGGATGCTGCAGACGGGGATCAAAAAGTCCTTAATGACGCTTTGAAG
TGGCTCGAAAAATACACAGAATTTGAGTAG
Transcript >OphauG2|4730
ATGTCACGGGCTCTCGACAAGGGCATTCAAGAGGCACTCGAGCAGGCCGACCTTGAAATTCCATTTAAGCACATA
TCCACAGCTTTATCACAGATTCGTGACGCCTTGCTCGACATTGAACTGTTGGGATCAAGCCACGCTTCGATTGAC
GCAACTCTACTCCAGGATGGCAATGCCATAGCAATCCCCAAGCGGCGCCTTGTGGAGGCTTTTATATGTGCACGG
AAAAGATTCATTTCCTTTCAGCAAAGCAAAGAGCTTCAAAACACGCGTAAACAACATGTGCTCTCTGTGACGGCC
GTCATGCTGCTTATGGATCCTGAGCATCTGACTGCGGCAAATGCGCGCAAACAAGTGCTCTCAGAGGCTTTGGAG
ATGTGTCCAAGTGACGTAGCACCTCTGTTGAATGAAAAGTTTTTGATAGACAGTCTTCTCACAAGTCACCTTCAT
CGACACACAAAGTCGCCGACCCTCTGGAGTCACCGGCGATGGCTGATGAGGAGAATCAGTGCCATGGGAGCAGCA
AACAATATCGTTGAGGAACTGGCAAGCGTTGTCTTCGTCTCAGCCGAGAGACATCCGCGAAATTACTATGCATGG
GGCCATGCTAGGCTCCTTGTCGAGTCTACCGTCGCCCACAGCGGCAAACCTGAAGCCGAGCTGGATATAAAAAGA
ATGGTACAAGACACCAAGAAATGGTGCTTCAACCACCACGATGATGTTTCTGGCTGGATGTTTTTAGCTTTTCTC
CTTGAGAAATGGCCCTCTTGCACCGCGTCTGTCTTGCGAGAAACGTTGCAGCTTGTCCAATCGTTTCGATGGCGC
AACGAATCAGTATGGCATTTTCTTCGCAATGTGGTGTCAATGCAATCTCAGGCAGCAGGGCTGTCAGTGAATCAA
GTTCGAACCGTCTGTAATGCTCTCCTCAAGGATGCTGCAGACGGGGATCAAAAAGTCCTTAATGACGCTTTGAAG
TGGCTCGAAAAATACACAGAATTTGAGTAG
Gene >OphauG2|4730
ATGTCACGGGCTCTCGACAAGGGCATTCAAGAGGCACTCGAGCAGGCCGACCTTGAAATTCCATTTAAGCACATA
TCCACAGCTTTATCACAGATTCGTGACGCCTTGCTCGACATTGAACTGTTGGGATCAAGCCACGCTTCGATTGAC
GCAACTCTACTCCAGGATGGCAATGCCATAGCAATCCCCAAGCGGCGCCTTGTGGAGGCTTTTATATGTGCACGG
AAAAGATTCATTTCCTTTCAGCAAAGCAAAGAGCTTCAAAACACGCGTAAACAACATGTGCTCTCTGTGACGGCC
GTCATGCTGCTTATGGATCCTGAGCATCTGACTGCGGCAAATGCGCGCAAACAAGTGCTCTCAGAGGCTTTGGAG
ATGTGTCCAAGTGACGTAGCACCTCTGTTGAATGAAAAGTTTTTGATAGACAGTCTTCTCACAAGTCACCTTCAT
CGACACACAAAGTCGCCGACCCTCTGGAGTCACCGGCGATGGCTGATGAGGAGAATCAGTGCCATGGGAGCAGCA
AACAATATCGTTGAGGAACTGGCAAGCGTTGTCTTCGTCTCAGCCGAGAGACATCCGCGAAATTACTATGCATGG
GGCCATGCTAGGCTCCTTGTCGAGTCTACCGTCGCCCACAGCGGCAAACCTGAAGCCGAGCTGGATATAAAAAGA
ATGGTACAAGACACCAAGAAATGGTGCTTCAACCACCACGATGATGTTTCTGGCTGGATGTTTTTAGCTTTTCTC
CTTGAGAAATGGCCCTCTTGCACCGCGTCTGTCTTGCGAGAAACGTTGCAGCTTGTCCAATCGTTTCGATGGCGC
AACGAATCAGTATGGCATTTTCTTCGCAATGTGGTGTCAATGCAATCTCAGGCAGCAGGGCTGTCAGTGAATCAA
GTTCGAACCGTCTGTAATGCTCTCCTCAAGGATGCTGCAGACGGGGATCAAAAAGTCCTTAATGACGCTTTGAAG
TGGCTCGAAAAATACACAGAATTTGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail