Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4730
Gene name
LocationContig_403:7225..8230
Strand+
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 2.0E-04 146 168
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 8.6E-04 180 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A1L3L1|PTR1B_XENLA Protein prenyltransferase alpha subunit repeat-containing protein 1-B (Fragment) OS=Xenopus laevis GN=ptar1-b PE=2 SV=1 77 252 4.0E-10
sp|Q02202|ECM9_YEAST Protein ECM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM9 PE=1 SV=2 93 272 2.0E-08
sp|Q0IHB3|PTR1A_XENLA Protein prenyltransferase alpha subunit repeat-containing protein 1-A OS=Xenopus laevis GN=ptar1-a PE=2 SV=1 76 249 2.0E-08
sp|A3KPW7|PTAR1_DANRE Protein prenyltransferase alpha subunit repeat-containing protein 1 OS=Danio rerio GN=ptar1 PE=2 SV=1 92 252 8.0E-07

GO

GO Term Description Terminal node
GO:0008318 protein prenyltransferase activity Yes
GO:0018342 protein prenylation Yes
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0097354 prenylation No
GO:0008152 metabolic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0004659 prenyltransferase activity No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4730
MSRALDKGIQEALEQADLEIPFKHISTALSQIRDALLDIELLGSSHASIDATLLQDGNAIAIPKRRLVEAFICAR
KRFISFQQSKELQNTRKQHVLSVTAVMLLMDPEHLTAANARKQVLSEALEMCPSDVAPLLNEKFLIDSLLTSHLH
RHTKSPTLWSHRRWLMRRISAMGAANNIVEELASVVFVSAERHPRNYYAWGHARLLVESTVAHSGKPEAELDIKR
MVQDTKKWCFNHHDDVSGWMFLAFLLEKWPSCTASVLRETLQLVQSFRWRNESVWHFLRNVVSMQSQAAGLSVNQ
VRTVCNALLKDAADGDQKVLNDALKWLEKYTEFE*
Coding >OphauG2|4730
ATGTCACGGGCTCTCGACAAGGGCATTCAAGAGGCACTCGAGCAGGCCGACCTTGAAATTCCATTTAAGCACATA
TCCACAGCTTTATCACAGATTCGTGACGCCTTGCTCGACATTGAACTGTTGGGATCAAGCCACGCTTCGATTGAC
GCAACTCTACTCCAGGATGGCAATGCCATAGCAATCCCCAAGCGGCGCCTTGTGGAGGCTTTTATATGTGCACGG
AAAAGATTCATTTCCTTTCAGCAAAGCAAAGAGCTTCAAAACACGCGTAAACAACATGTGCTCTCTGTGACGGCC
GTCATGCTGCTTATGGATCCTGAGCATCTGACTGCGGCAAATGCGCGCAAACAAGTGCTCTCAGAGGCTTTGGAG
ATGTGTCCAAGTGACGTAGCACCTCTGTTGAATGAAAAGTTTTTGATAGACAGTCTTCTCACAAGTCACCTTCAT
CGACACACAAAGTCGCCGACCCTCTGGAGTCACCGGCGATGGCTGATGAGGAGAATCAGTGCCATGGGAGCAGCA
AACAATATCGTTGAGGAACTGGCAAGCGTTGTCTTCGTCTCAGCCGAGAGACATCCGCGAAATTACTATGCATGG
GGCCATGCTAGGCTCCTTGTCGAGTCTACCGTCGCCCACAGCGGCAAACCTGAAGCCGAGCTGGATATAAAAAGA
ATGGTACAAGACACCAAGAAATGGTGCTTCAACCACCACGATGATGTTTCTGGCTGGATGTTTTTAGCTTTTCTC
CTTGAGAAATGGCCCTCTTGCACCGCGTCTGTCTTGCGAGAAACGTTGCAGCTTGTCCAATCGTTTCGATGGCGC
AACGAATCAGTATGGCATTTTCTTCGCAATGTGGTGTCAATGCAATCTCAGGCAGCAGGGCTGTCAGTGAATCAA
GTTCGAACCGTCTGTAATGCTCTCCTCAAGGATGCTGCAGACGGGGATCAAAAAGTCCTTAATGACGCTTTGAAG
TGGCTCGAAAAATACACAGAATTTGAGTAG
Transcript >OphauG2|4730
ATGTCACGGGCTCTCGACAAGGGCATTCAAGAGGCACTCGAGCAGGCCGACCTTGAAATTCCATTTAAGCACATA
TCCACAGCTTTATCACAGATTCGTGACGCCTTGCTCGACATTGAACTGTTGGGATCAAGCCACGCTTCGATTGAC
GCAACTCTACTCCAGGATGGCAATGCCATAGCAATCCCCAAGCGGCGCCTTGTGGAGGCTTTTATATGTGCACGG
AAAAGATTCATTTCCTTTCAGCAAAGCAAAGAGCTTCAAAACACGCGTAAACAACATGTGCTCTCTGTGACGGCC
GTCATGCTGCTTATGGATCCTGAGCATCTGACTGCGGCAAATGCGCGCAAACAAGTGCTCTCAGAGGCTTTGGAG
ATGTGTCCAAGTGACGTAGCACCTCTGTTGAATGAAAAGTTTTTGATAGACAGTCTTCTCACAAGTCACCTTCAT
CGACACACAAAGTCGCCGACCCTCTGGAGTCACCGGCGATGGCTGATGAGGAGAATCAGTGCCATGGGAGCAGCA
AACAATATCGTTGAGGAACTGGCAAGCGTTGTCTTCGTCTCAGCCGAGAGACATCCGCGAAATTACTATGCATGG
GGCCATGCTAGGCTCCTTGTCGAGTCTACCGTCGCCCACAGCGGCAAACCTGAAGCCGAGCTGGATATAAAAAGA
ATGGTACAAGACACCAAGAAATGGTGCTTCAACCACCACGATGATGTTTCTGGCTGGATGTTTTTAGCTTTTCTC
CTTGAGAAATGGCCCTCTTGCACCGCGTCTGTCTTGCGAGAAACGTTGCAGCTTGTCCAATCGTTTCGATGGCGC
AACGAATCAGTATGGCATTTTCTTCGCAATGTGGTGTCAATGCAATCTCAGGCAGCAGGGCTGTCAGTGAATCAA
GTTCGAACCGTCTGTAATGCTCTCCTCAAGGATGCTGCAGACGGGGATCAAAAAGTCCTTAATGACGCTTTGAAG
TGGCTCGAAAAATACACAGAATTTGAGTAG
Gene >OphauG2|4730
ATGTCACGGGCTCTCGACAAGGGCATTCAAGAGGCACTCGAGCAGGCCGACCTTGAAATTCCATTTAAGCACATA
TCCACAGCTTTATCACAGATTCGTGACGCCTTGCTCGACATTGAACTGTTGGGATCAAGCCACGCTTCGATTGAC
GCAACTCTACTCCAGGATGGCAATGCCATAGCAATCCCCAAGCGGCGCCTTGTGGAGGCTTTTATATGTGCACGG
AAAAGATTCATTTCCTTTCAGCAAAGCAAAGAGCTTCAAAACACGCGTAAACAACATGTGCTCTCTGTGACGGCC
GTCATGCTGCTTATGGATCCTGAGCATCTGACTGCGGCAAATGCGCGCAAACAAGTGCTCTCAGAGGCTTTGGAG
ATGTGTCCAAGTGACGTAGCACCTCTGTTGAATGAAAAGTTTTTGATAGACAGTCTTCTCACAAGTCACCTTCAT
CGACACACAAAGTCGCCGACCCTCTGGAGTCACCGGCGATGGCTGATGAGGAGAATCAGTGCCATGGGAGCAGCA
AACAATATCGTTGAGGAACTGGCAAGCGTTGTCTTCGTCTCAGCCGAGAGACATCCGCGAAATTACTATGCATGG
GGCCATGCTAGGCTCCTTGTCGAGTCTACCGTCGCCCACAGCGGCAAACCTGAAGCCGAGCTGGATATAAAAAGA
ATGGTACAAGACACCAAGAAATGGTGCTTCAACCACCACGATGATGTTTCTGGCTGGATGTTTTTAGCTTTTCTC
CTTGAGAAATGGCCCTCTTGCACCGCGTCTGTCTTGCGAGAAACGTTGCAGCTTGTCCAATCGTTTCGATGGCGC
AACGAATCAGTATGGCATTTTCTTCGCAATGTGGTGTCAATGCAATCTCAGGCAGCAGGGCTGTCAGTGAATCAA
GTTCGAACCGTCTGTAATGCTCTCCTCAAGGATGCTGCAGACGGGGATCAAAAAGTCCTTAATGACGCTTTGAAG
TGGCTCGAAAAATACACAGAATTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail