Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4723
Gene name
LocationContig_402:4341..5157
Strand+
Gene length (bp)816
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 1.1E-28 40 169
PF08241 Methyltransf_11 Methyltransferase domain 2.3E-21 44 141
PF13649 Methyltransf_25 Methyltransferase domain 4.0E-21 43 138
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.1E-17 23 162
PF13489 Methyltransf_23 Methyltransferase domain 9.8E-13 38 192
PF08242 Methyltransf_12 Methyltransferase domain 3.1E-12 44 139
PF07021 MetW Methionine biosynthesis protein MetW 1.0E-07 33 136
PF05175 MTS Methyltransferase small domain 1.2E-05 31 101
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.7E-05 26 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 9 271 9.0E-42
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 38 141 5.0E-16
sp|A7NF26|MENG_ROSCS Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 44 147 2.0E-13
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 37 197 2.0E-13
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 37 219 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 9 271 9.0E-42
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 38 141 5.0E-16
sp|A7NF26|MENG_ROSCS Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 44 147 2.0E-13
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 37 197 2.0E-13
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 37 219 3.0E-13
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 37 216 3.0E-13
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 37 147 2.0E-12
sp|Q4L6H3|MENG_STAHJ Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 36 216 2.0E-12
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 37 216 3.0E-12
sp|B9DNV5|MENG_STACT Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 36 216 5.0E-12
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 36 233 1.0E-11
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 34 147 1.0E-11
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 40 147 2.0E-11
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 36 192 3.0E-11
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 36 192 3.0E-11
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 36 232 3.0E-11
sp|Q5WGT4|MENG_BACSK Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 9 147 4.0E-11
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 36 150 9.0E-11
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 34 147 1.0E-10
sp|Q87TH4|UBIE_VIBPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 38 158 2.0E-10
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 38 146 2.0E-10
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 37 143 3.0E-10
sp|A7MTX1|UBIE_VIBCB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 38 161 3.0E-10
sp|A7GN50|MENG_BACCN Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 19 150 4.0E-10
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 36 219 6.0E-10
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 36 152 6.0E-10
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 37 135 7.0E-10
sp|Q7MQ33|UBIE_VIBVY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 38 161 7.0E-10
sp|Q8DDP9|UBIE_VIBVU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 38 161 7.0E-10
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 43 138 1.0E-09
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 9 147 1.0E-09
sp|Q5X0X6|UBIE_LEGPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Paris) GN=ubiE PE=3 SV=1 34 161 1.0E-09
sp|A9VMC2|MENG_BACWK Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 19 150 1.0E-09
sp|Q5WSQ8|UBIE_LEGPL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Lens) GN=ubiE PE=3 SV=1 34 161 1.0E-09
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 19 150 1.0E-09
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 36 152 2.0E-09
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A4JHS6|UBIE_BURVG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 36 161 2.0E-09
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|Q6MHQ3|UBIE_BDEBA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ubiE PE=3 SV=1 38 141 2.0E-09
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|Q9XAP8|MENG_STRCO Demethylmenaquinone methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=menG PE=3 SV=1 38 153 2.0E-09
sp|A5UVB2|MENG_ROSS1 Demethylmenaquinone methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=menG PE=3 SV=1 44 147 2.0E-09
sp|Q5ZRH9|UBIE_LEGPH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ubiE PE=3 SV=1 34 161 3.0E-09
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 19 150 3.0E-09
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 36 146 4.0E-09
sp|Q9KCC4|MENG_BACHD Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 36 150 4.0E-09
sp|A5II90|UBIE_LEGPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Corby) GN=ubiE PE=3 SV=1 34 161 5.0E-09
sp|A6VTA1|UBIE_MARMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 37 158 6.0E-09
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 37 147 6.0E-09
sp|P94298|MENG_BACPE Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 37 150 7.0E-09
sp|Q2SN12|UBIE_HAHCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 37 146 7.0E-09
sp|O52025|ARSM_HALSA Putative arsenite methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsM PE=2 SV=1 39 153 1.0E-08
sp|Q1R477|UBIE_ECOUT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q8FBJ0|UBIE_ECOL6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q0TAM1|UBIE_ECOL5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|A1AI22|UBIE_ECOK1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O1:K1 / APEC GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7N2E1|UBIE_ECO81 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O81 (strain ED1a) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7MHC0|UBIE_ECO45 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q3YVD2|UBIE_SHISS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella sonnei (strain Ss046) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|P0A889|UBIE_SHIFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q0SZ25|UBIE_SHIF8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q32A11|UBIE_SHIDS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q31UF3|UBIE_SHIBS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B2TVI4|UBIE_SHIB3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B1LM21|UBIE_ECOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B6I4H5|UBIE_ECOSE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SE11) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7NFD6|UBIE_ECOLU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|P0A887|UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) GN=ubiE PE=1 SV=1 23 158 1.0E-08
sp|B1IW72|UBIE_ECOLC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|A8A6U0|UBIE_ECOHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O9:H4 (strain HS) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B1XAJ7|UBIE_ECODH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / DH10B) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|C5A009|UBIE_ECOBW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7M638|UBIE_ECO8A Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O8 (strain IAI1) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7NV33|UBIE_ECO7I Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B5YY82|UBIE_ECO5E Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|P0A888|UBIE_ECO57 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7L996|UBIE_ECO55 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain 55989 / EAEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7UNG3|UBIE_ECO27 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|A7ZU40|UBIE_ECO24 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 38 146 1.0E-08
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|A4WFY5|UBIE_ENT38 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Enterobacter sp. (strain 638) GN=ubiE PE=3 SV=1 23 158 2.0E-08
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|A3PUJ1|MENG_MYCSJ Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain JLS) GN=menG PE=3 SV=1 23 193 2.0E-08
sp|A8G0S7|UBIE_SHESH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|C3LPS5|UBIE_VIBCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 38 158 3.0E-08
sp|Q9KVQ6|UBIE_VIBCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 38 158 3.0E-08
sp|A5F4E5|UBIE_VIBC3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 38 158 3.0E-08
sp|B0TJ16|UBIE_SHEHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 38 146 3.0E-08
sp|B2HRQ2|MENG_MYCMM Demethylmenaquinone methyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=menG PE=3 SV=1 23 193 3.0E-08
sp|A6TGL3|UBIE_KLEP7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 23 158 3.0E-08
sp|B5XYI1|UBIE_KLEP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 23 158 3.0E-08
sp|Q1BE01|MENG_MYCSS Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain MCS) GN=menG PE=3 SV=1 23 193 3.0E-08
sp|A1UAY5|MENG_MYCSK Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain KMS) GN=menG PE=3 SV=1 23 193 3.0E-08
sp|B4EBC4|UBIE_BURCJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 36 161 4.0E-08
sp|B1JYJ6|UBIE_BURCC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 36 161 4.0E-08
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 23 146 5.0E-08
sp|Q0BBY4|UBIE_BURCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|A0KAF5|UBIE_BURCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|Q1BTN4|UBIE_BURCA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|B1YWF9|UBIE_BURA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 36 266 5.0E-08
sp|A1JIF2|UBIE_YERE8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 23 158 7.0E-08
sp|B7LU01|UBIE_ESCF3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiE PE=3 SV=1 23 158 7.0E-08
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 37 157 8.0E-08
sp|A3QIE1|UBIE_SHELP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 38 146 8.0E-08
sp|B1JP75|UBIE_YERPY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q66FT0|UBIE_YERPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|A4TR39|UBIE_YERPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis (strain Pestoides F) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q1CNB4|UBIE_YERPN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|A9R431|UBIE_YERPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q8D1I3|UBIE_YERPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|B2K0Y4|UBIE_YERPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|A7FDE0|UBIE_YERP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q1CBG0|UBIE_YERPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiE PE=3 SV=1 23 158 9.0E-08
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 23 158 1.0E-07
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 21 142 1.0E-07
sp|A4SM99|UBIG_AERS4 Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 40 140 1.0E-07
sp|A0PLV5|MENG_MYCUA Demethylmenaquinone methyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=menG PE=3 SV=1 23 193 1.0E-07
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 34 147 1.0E-07
sp|Q9CKD6|UBIE_PASMU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 23 158 2.0E-07
sp|C5BRL2|UBIE_TERTT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 37 146 2.0E-07
sp|A9AFC0|UBIE_BURM1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiE PE=3 SV=1 36 161 2.0E-07
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 38 146 2.0E-07
sp|Q39D13|UBIE_BURL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiE PE=3 SV=1 36 161 3.0E-07
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 37 135 3.0E-07
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 37 146 3.0E-07
sp|A8H966|UBIE_SHEPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 38 146 3.0E-07
sp|Q2T139|UBIE_BURTA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|Q63XA0|UBIE_BURPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain K96243) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3N5U8|UBIE_BURP6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 668) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|Q3JVZ6|UBIE_BURP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1710b) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3NRJ4|UBIE_BURP0 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1106a) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A1V753|UBIE_BURMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain SAVP1) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|Q62MP4|UBIE_BURMA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain ATCC 23344) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A2S8L1|UBIE_BURM9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10229) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3MNT8|UBIE_BURM7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10247) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3PNM3|UBIG_RHOS1 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiG PE=3 SV=1 40 143 4.0E-07
sp|Q8YLP4|MENG_NOSS1 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=menG PE=3 SV=1 38 137 4.0E-07
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 37 141 5.0E-07
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 37 146 5.0E-07
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 37 146 5.0E-07
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 37 146 5.0E-07
sp|A4WW91|UBIG_RHOS5 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiG PE=3 SV=1 40 143 5.0E-07
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 37 143 6.0E-07
sp|P9WFR3|MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menG PE=1 SV=1 23 189 6.0E-07
sp|P9WFR2|MENG_MYCTO Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|A5TZT8|MENG_MYCTA Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|C1AKN8|MENG_MYCBT Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|A1KG35|MENG_MYCBP Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|P0A639|MENG_MYCBO Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|A1T1P0|Y241_MYCVP Uncharacterized methyltransferase Mvan_0241 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_0241 PE=3 SV=1 40 138 6.0E-07
sp|D8MPW4|BIOC_ERWBE Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia billingiae (strain Eb661) GN=bioC PE=3 SV=1 38 173 7.0E-07
sp|Q3MD91|MENG_ANAVT 2-phytyl-1,4-naphtoquinone methyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=menG PE=3 SV=1 38 137 7.0E-07
sp|Q73SL8|MENG_MYCPA Demethylmenaquinone methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=menG PE=3 SV=2 23 192 7.0E-07
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 44 140 7.0E-07
sp|B9KPP7|UBIG_RHOSK Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiG PE=3 SV=1 40 143 8.0E-07
sp|B8CI06|UBIE_SHEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 38 146 1.0E-06
sp|P46326|YXBB_BACSU Uncharacterized protein YxbB OS=Bacillus subtilis (strain 168) GN=yxbB PE=3 SV=1 42 163 1.0E-06
sp|D2T333|BIOC_ERWP6 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=bioC PE=3 SV=1 33 141 1.0E-06
sp|Q3IYM5|UBIG_RHOS4 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiG PE=3 SV=1 40 143 1.0E-06
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 40 138 1.0E-06
sp|A1SE26|MENG_NOCSJ Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 38 192 2.0E-06
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 40 140 2.0E-06
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 40 140 2.0E-06
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 40 140 2.0E-06
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 39 140 2.0E-06
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 39 140 2.0E-06
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 39 140 2.0E-06
sp|Q9CBA8|MENG_MYCLE Demethylmenaquinone methyltransferase OS=Mycobacterium leprae (strain TN) GN=menG PE=3 SV=2 23 192 2.0E-06
sp|Q8Y278|UBIE_RALSO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia solanacearum (strain GMI1000) GN=ubiE PE=3 SV=1 37 161 2.0E-06
sp|B5EFL1|UBIE_GEOBB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ubiE PE=3 SV=1 43 147 3.0E-06
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 41 140 4.0E-06
sp|B2VIL6|UBIG_ERWT9 Ubiquinone biosynthesis O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiG PE=3 SV=1 40 140 6.0E-06
sp|Q21UL3|UBIG_RHOFT Ubiquinone biosynthesis O-methyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ubiG PE=3 SV=1 34 138 6.0E-06
sp|B8EI29|UBIG_METSB Ubiquinone biosynthesis O-methyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ubiG PE=3 SV=1 35 128 8.0E-06
sp|B4EZ30|UBIG_PROMH Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 40 140 8.0E-06
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 32 140 1.0E-05
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 40 140 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4723
MAASHPSVYATDHSAPVLRTHSWRTAANSCAYLIPHVRPGFTVLDVGCGPGSITLDLARLVPDGHVTGLENVPEP
LHAARALATEQAVSNVSFCLGDIHALPFDNDCFDVVHAHQVLQHVADPVAALREMRRVARSDGGIVACRESAAMT
WFPASEPLEAWRRLTTAIAAHKGGNPHPGARIHVWAQQAGFSRDRILKSTDSWCFSSDSEREYWGGSMAQRARAP
AFVNMALDHGHSTPHELHLIAAGWDAFCRDADAWFGLLHGQILCRN*
Coding >OphauG2|4723
ATGGCCGCCTCTCACCCTTCTGTCTATGCCACGGACCATTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGCACA
GCCGCCAACTCTTGCGCCTATCTGATTCCCCATGTCCGCCCCGGCTTCACCGTGCTCGACGTGGGCTGCGGCCCG
GGCTCCATCACCCTTGATCTCGCGCGCCTTGTGCCAGACGGCCACGTCACGGGCCTTGAAAACGTGCCCGAGCCG
CTCCATGCCGCCCGCGCCCTGGCCACTGAGCAGGCCGTCTCCAACGTGAGCTTCTGCTTGGGCGACATCCATGCC
CTGCCATTTGACAATGACTGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTGGCCGACCCCGTCGCC
GCCCTGCGCGAGATGCGTCGCGTCGCCCGCTCTGACGGCGGCATCGTTGCCTGCCGTGAGTCGGCTGCCATGACT
TGGTTTCCCGCCTCGGAGCCGCTCGAGGCCTGGCGCCGCCTGACCACGGCCATTGCCGCACACAAAGGCGGAAAC
CCACACCCAGGTGCACGCATCCACGTCTGGGCTCAACAGGCTGGCTTCTCCAGAGACAGAATCCTCAAAAGCACC
GACTCGTGGTGCTTTAGTAGCGATTCTGAGCGCGAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCGCCC
GCCTTTGTCAACATGGCCCTCGACCACGGCCACTCGACGCCCCACGAGCTGCACCTTATTGCCGCCGGCTGGGAT
GCTTTTTGTCGAGATGCAGATGCATGGTTTGGCTTGTTACATGGCCAGATTCTCTGCCGCAACTAA
Transcript >OphauG2|4723
ATGGCCGCCTCTCACCCTTCTGTCTATGCCACGGACCATTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGCACA
GCCGCCAACTCTTGCGCCTATCTGATTCCCCATGTCCGCCCCGGCTTCACCGTGCTCGACGTGGGCTGCGGCCCG
GGCTCCATCACCCTTGATCTCGCGCGCCTTGTGCCAGACGGCCACGTCACGGGCCTTGAAAACGTGCCCGAGCCG
CTCCATGCCGCCCGCGCCCTGGCCACTGAGCAGGCCGTCTCCAACGTGAGCTTCTGCTTGGGCGACATCCATGCC
CTGCCATTTGACAATGACTGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTGGCCGACCCCGTCGCC
GCCCTGCGCGAGATGCGTCGCGTCGCCCGCTCTGACGGCGGCATCGTTGCCTGCCGTGAGTCGGCTGCCATGACT
TGGTTTCCCGCCTCGGAGCCGCTCGAGGCCTGGCGCCGCCTGACCACGGCCATTGCCGCACACAAAGGCGGAAAC
CCACACCCAGGTGCACGCATCCACGTCTGGGCTCAACAGGCTGGCTTCTCCAGAGACAGAATCCTCAAAAGCACC
GACTCGTGGTGCTTTAGTAGCGATTCTGAGCGCGAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCGCCC
GCCTTTGTCAACATGGCCCTCGACCACGGCCACTCGACGCCCCACGAGCTGCACCTTATTGCCGCCGGCTGGGAT
GCTTTTTGTCGAGATGCAGATGCATGGTTTGGCTTGTTACATGGCCAGATTCTCTGCCGCAACTAA
Gene >OphauG2|4723
ATGGCCGCCTCTCACCCTTCTGTCTATGCCACGGACCATTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGCACA
GCCGCCAACTCTTGCGCCTATCTGATTCCCCATGTCCGCCCCGGCTTCACCGTGCTCGACGTGGGCTGCGGCCCG
GGCTCCATCACCCTTGATCTCGCGCGCCTTGTGCCAGACGGCCACGTCACGGGCCTTGAAAACGTGCCCGAGCCG
CTCCATGCCGCCCGCGCCCTGGCCACTGAGCAGGCCGTCTCCAACGTGAGCTTCTGCTTGGGCGACATCCATGCC
CTGCCATTTGACAATGACTGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTGGCCGACCCCGTCGCC
GCCCTGCGCGAGATGCGTCGCGTCGCCCGCTCTGACGGCGGCATCGTTGCCTGCCGTGAGTCGGCTGCCATGACT
TGGTTTCCCGCCTCGGAGCCGCTCGAGGCCTGGCGCCGCCTGACCACGGCCATTGCCGCACACAAAGGCGGAAAC
CCACACCCAGGTGCACGCATCCACGTCTGGGCTCAACAGGCTGGCTTCTCCAGAGACAGAATCCTCAAAAGCACC
GACTCGTGGTGCTTTAGTAGCGATTCTGAGCGCGAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCGCCC
GCCTTTGTCAACATGGCCCTCGACCACGGCCACTCGACGCCCCACGAGCTGCACCTTATTGCCGCCGGCTGGGAT
GCTTTTTGTCGAGATGCAGATGCATGGTTTGGCTTGTTACATGGCCAGATTCTCTGCCGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail