Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4723
Gene name
LocationContig_402:4341..5157
Strand+
Gene length (bp)816
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 1.1E-28 40 169
PF08241 Methyltransf_11 Methyltransferase domain 2.3E-21 44 141
PF13649 Methyltransf_25 Methyltransferase domain 4.0E-21 43 138
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.1E-17 23 162
PF13489 Methyltransf_23 Methyltransferase domain 9.8E-13 38 192
PF08242 Methyltransf_12 Methyltransferase domain 3.1E-12 44 139
PF07021 MetW Methionine biosynthesis protein MetW 1.0E-07 33 136
PF05175 MTS Methyltransferase small domain 1.2E-05 31 101
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.7E-05 26 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 9 271 9.0E-42
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 38 141 5.0E-16
sp|A7NF26|MENG_ROSCS Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 44 147 2.0E-13
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 37 197 2.0E-13
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 37 219 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 9 271 9.0E-42
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 38 141 5.0E-16
sp|A7NF26|MENG_ROSCS Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 44 147 2.0E-13
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 37 197 2.0E-13
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 37 219 3.0E-13
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 37 216 3.0E-13
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 37 216 3.0E-13
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 37 197 1.0E-12
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 37 147 2.0E-12
sp|Q4L6H3|MENG_STAHJ Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 36 216 2.0E-12
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 37 216 3.0E-12
sp|B9DNV5|MENG_STACT Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 36 216 5.0E-12
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 36 233 1.0E-11
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 34 147 1.0E-11
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 40 147 2.0E-11
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 36 192 3.0E-11
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 36 192 3.0E-11
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 36 232 3.0E-11
sp|Q5WGT4|MENG_BACSK Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 9 147 4.0E-11
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 36 150 9.0E-11
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 34 147 1.0E-10
sp|Q87TH4|UBIE_VIBPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 38 158 2.0E-10
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 38 146 2.0E-10
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 37 143 3.0E-10
sp|A7MTX1|UBIE_VIBCB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 38 161 3.0E-10
sp|A7GN50|MENG_BACCN Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 19 150 4.0E-10
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 36 219 6.0E-10
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 36 152 6.0E-10
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 37 135 7.0E-10
sp|Q7MQ33|UBIE_VIBVY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 38 161 7.0E-10
sp|Q8DDP9|UBIE_VIBVU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 38 161 7.0E-10
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 43 138 1.0E-09
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 9 147 1.0E-09
sp|Q5X0X6|UBIE_LEGPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Paris) GN=ubiE PE=3 SV=1 34 161 1.0E-09
sp|A9VMC2|MENG_BACWK Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 19 150 1.0E-09
sp|Q5WSQ8|UBIE_LEGPL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Lens) GN=ubiE PE=3 SV=1 34 161 1.0E-09
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 19 150 1.0E-09
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 36 152 2.0E-09
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A4JHS6|UBIE_BURVG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 36 161 2.0E-09
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|Q6MHQ3|UBIE_BDEBA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ubiE PE=3 SV=1 38 141 2.0E-09
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 38 146 2.0E-09
sp|Q9XAP8|MENG_STRCO Demethylmenaquinone methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=menG PE=3 SV=1 38 153 2.0E-09
sp|A5UVB2|MENG_ROSS1 Demethylmenaquinone methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=menG PE=3 SV=1 44 147 2.0E-09
sp|Q5ZRH9|UBIE_LEGPH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ubiE PE=3 SV=1 34 161 3.0E-09
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 19 150 3.0E-09
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 19 150 3.0E-09
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 36 146 4.0E-09
sp|Q9KCC4|MENG_BACHD Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 36 150 4.0E-09
sp|A5II90|UBIE_LEGPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Corby) GN=ubiE PE=3 SV=1 34 161 5.0E-09
sp|A6VTA1|UBIE_MARMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 37 158 6.0E-09
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 19 150 6.0E-09
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 37 147 6.0E-09
sp|P94298|MENG_BACPE Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 37 150 7.0E-09
sp|Q2SN12|UBIE_HAHCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 37 146 7.0E-09
sp|O52025|ARSM_HALSA Putative arsenite methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsM PE=2 SV=1 39 153 1.0E-08
sp|Q1R477|UBIE_ECOUT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q8FBJ0|UBIE_ECOL6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q0TAM1|UBIE_ECOL5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|A1AI22|UBIE_ECOK1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O1:K1 / APEC GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7N2E1|UBIE_ECO81 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O81 (strain ED1a) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7MHC0|UBIE_ECO45 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q3YVD2|UBIE_SHISS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella sonnei (strain Ss046) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|P0A889|UBIE_SHIFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q0SZ25|UBIE_SHIF8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q32A11|UBIE_SHIDS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q31UF3|UBIE_SHIBS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B2TVI4|UBIE_SHIB3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B1LM21|UBIE_ECOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B6I4H5|UBIE_ECOSE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SE11) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7NFD6|UBIE_ECOLU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|P0A887|UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) GN=ubiE PE=1 SV=1 23 158 1.0E-08
sp|B1IW72|UBIE_ECOLC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|A8A6U0|UBIE_ECOHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O9:H4 (strain HS) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B1XAJ7|UBIE_ECODH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / DH10B) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|C5A009|UBIE_ECOBW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7M638|UBIE_ECO8A Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O8 (strain IAI1) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7NV33|UBIE_ECO7I Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B5YY82|UBIE_ECO5E Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|P0A888|UBIE_ECO57 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7L996|UBIE_ECO55 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain 55989 / EAEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|B7UNG3|UBIE_ECO27 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|A7ZU40|UBIE_ECO24 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiE PE=3 SV=1 23 158 1.0E-08
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 38 146 1.0E-08
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|A4WFY5|UBIE_ENT38 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Enterobacter sp. (strain 638) GN=ubiE PE=3 SV=1 23 158 2.0E-08
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|A3PUJ1|MENG_MYCSJ Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain JLS) GN=menG PE=3 SV=1 23 193 2.0E-08
sp|A8G0S7|UBIE_SHESH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 38 146 2.0E-08
sp|C3LPS5|UBIE_VIBCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 38 158 3.0E-08
sp|Q9KVQ6|UBIE_VIBCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 38 158 3.0E-08
sp|A5F4E5|UBIE_VIBC3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 38 158 3.0E-08
sp|B0TJ16|UBIE_SHEHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 38 146 3.0E-08
sp|B2HRQ2|MENG_MYCMM Demethylmenaquinone methyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=menG PE=3 SV=1 23 193 3.0E-08
sp|A6TGL3|UBIE_KLEP7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 23 158 3.0E-08
sp|B5XYI1|UBIE_KLEP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 23 158 3.0E-08
sp|Q1BE01|MENG_MYCSS Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain MCS) GN=menG PE=3 SV=1 23 193 3.0E-08
sp|A1UAY5|MENG_MYCSK Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain KMS) GN=menG PE=3 SV=1 23 193 3.0E-08
sp|B4EBC4|UBIE_BURCJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 36 161 4.0E-08
sp|B1JYJ6|UBIE_BURCC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 36 161 4.0E-08
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 23 146 5.0E-08
sp|Q0BBY4|UBIE_BURCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|A0KAF5|UBIE_BURCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|Q1BTN4|UBIE_BURCA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|B1YWF9|UBIE_BURA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 36 161 5.0E-08
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 36 266 5.0E-08
sp|A1JIF2|UBIE_YERE8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 23 158 7.0E-08
sp|B7LU01|UBIE_ESCF3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiE PE=3 SV=1 23 158 7.0E-08
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 37 157 8.0E-08
sp|A3QIE1|UBIE_SHELP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 38 146 8.0E-08
sp|B1JP75|UBIE_YERPY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q66FT0|UBIE_YERPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|A4TR39|UBIE_YERPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis (strain Pestoides F) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q1CNB4|UBIE_YERPN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|A9R431|UBIE_YERPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q8D1I3|UBIE_YERPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|B2K0Y4|UBIE_YERPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|A7FDE0|UBIE_YERP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiE PE=3 SV=1 23 158 8.0E-08
sp|Q1CBG0|UBIE_YERPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiE PE=3 SV=1 23 158 9.0E-08
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 23 158 1.0E-07
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 21 142 1.0E-07
sp|A4SM99|UBIG_AERS4 Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 40 140 1.0E-07
sp|A0PLV5|MENG_MYCUA Demethylmenaquinone methyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=menG PE=3 SV=1 23 193 1.0E-07
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 34 147 1.0E-07
sp|Q9CKD6|UBIE_PASMU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 23 158 2.0E-07
sp|C5BRL2|UBIE_TERTT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 37 146 2.0E-07
sp|A9AFC0|UBIE_BURM1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiE PE=3 SV=1 36 161 2.0E-07
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 38 146 2.0E-07
sp|Q39D13|UBIE_BURL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiE PE=3 SV=1 36 161 3.0E-07
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 37 135 3.0E-07
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 37 146 3.0E-07
sp|A8H966|UBIE_SHEPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 38 146 3.0E-07
sp|Q2T139|UBIE_BURTA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|Q63XA0|UBIE_BURPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain K96243) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3N5U8|UBIE_BURP6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 668) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|Q3JVZ6|UBIE_BURP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1710b) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3NRJ4|UBIE_BURP0 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1106a) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A1V753|UBIE_BURMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain SAVP1) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|Q62MP4|UBIE_BURMA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain ATCC 23344) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A2S8L1|UBIE_BURM9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10229) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3MNT8|UBIE_BURM7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10247) GN=ubiE PE=3 SV=1 36 161 4.0E-07
sp|A3PNM3|UBIG_RHOS1 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiG PE=3 SV=1 40 143 4.0E-07
sp|Q8YLP4|MENG_NOSS1 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=menG PE=3 SV=1 38 137 4.0E-07
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 37 141 5.0E-07
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 37 146 5.0E-07
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 37 146 5.0E-07
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 37 146 5.0E-07
sp|A4WW91|UBIG_RHOS5 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiG PE=3 SV=1 40 143 5.0E-07
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 37 143 6.0E-07
sp|P9WFR3|MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menG PE=1 SV=1 23 189 6.0E-07
sp|P9WFR2|MENG_MYCTO Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|A5TZT8|MENG_MYCTA Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|C1AKN8|MENG_MYCBT Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|A1KG35|MENG_MYCBP Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|P0A639|MENG_MYCBO Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=menG PE=3 SV=1 23 189 6.0E-07
sp|A1T1P0|Y241_MYCVP Uncharacterized methyltransferase Mvan_0241 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_0241 PE=3 SV=1 40 138 6.0E-07
sp|D8MPW4|BIOC_ERWBE Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia billingiae (strain Eb661) GN=bioC PE=3 SV=1 38 173 7.0E-07
sp|Q3MD91|MENG_ANAVT 2-phytyl-1,4-naphtoquinone methyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=menG PE=3 SV=1 38 137 7.0E-07
sp|Q73SL8|MENG_MYCPA Demethylmenaquinone methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=menG PE=3 SV=2 23 192 7.0E-07
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 44 140 7.0E-07
sp|B9KPP7|UBIG_RHOSK Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiG PE=3 SV=1 40 143 8.0E-07
sp|B8CI06|UBIE_SHEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 38 146 1.0E-06
sp|P46326|YXBB_BACSU Uncharacterized protein YxbB OS=Bacillus subtilis (strain 168) GN=yxbB PE=3 SV=1 42 163 1.0E-06
sp|D2T333|BIOC_ERWP6 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=bioC PE=3 SV=1 33 141 1.0E-06
sp|Q3IYM5|UBIG_RHOS4 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiG PE=3 SV=1 40 143 1.0E-06
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 40 138 1.0E-06
sp|A1SE26|MENG_NOCSJ Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 38 192 2.0E-06
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 40 140 2.0E-06
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 40 140 2.0E-06
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 40 140 2.0E-06
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 39 140 2.0E-06
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 39 140 2.0E-06
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 39 140 2.0E-06
sp|Q9CBA8|MENG_MYCLE Demethylmenaquinone methyltransferase OS=Mycobacterium leprae (strain TN) GN=menG PE=3 SV=2 23 192 2.0E-06
sp|Q8Y278|UBIE_RALSO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia solanacearum (strain GMI1000) GN=ubiE PE=3 SV=1 37 161 2.0E-06
sp|B5EFL1|UBIE_GEOBB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ubiE PE=3 SV=1 43 147 3.0E-06
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 41 140 4.0E-06
sp|B2VIL6|UBIG_ERWT9 Ubiquinone biosynthesis O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiG PE=3 SV=1 40 140 6.0E-06
sp|Q21UL3|UBIG_RHOFT Ubiquinone biosynthesis O-methyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ubiG PE=3 SV=1 34 138 6.0E-06
sp|B8EI29|UBIG_METSB Ubiquinone biosynthesis O-methyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ubiG PE=3 SV=1 35 128 8.0E-06
sp|B4EZ30|UBIG_PROMH Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 40 140 8.0E-06
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 32 140 1.0E-05
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 40 140 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup214
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4723 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2906
Ophiocordyceps camponoti-floridani Ophcf2|02465
Ophiocordyceps camponoti-floridani Ophcf2|02470
Ophiocordyceps camponoti-rufipedis Ophun1|5445
Ophiocordyceps camponoti-rufipedis Ophun1|5450
Ophiocordyceps kimflemingae Ophio5|3934
Ophiocordyceps kimflemingae Ophio5|7220
Ophiocordyceps subramaniannii Hirsu2|1869
Ophiocordyceps subramaniannii Hirsu2|6618
Ophiocordyceps subramaniannii Hirsu2|8995

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4723
MAASHPSVYATDHSAPVLRTHSWRTAANSCAYLIPHVRPGFTVLDVGCGPGSITLDLARLVPDGHVTGLENVPEP
LHAARALATEQAVSNVSFCLGDIHALPFDNDCFDVVHAHQVLQHVADPVAALREMRRVARSDGGIVACRESAAMT
WFPASEPLEAWRRLTTAIAAHKGGNPHPGARIHVWAQQAGFSRDRILKSTDSWCFSSDSEREYWGGSMAQRARAP
AFVNMALDHGHSTPHELHLIAAGWDAFCRDADAWFGLLHGQILCRN*
Coding >OphauG2|4723
ATGGCCGCCTCTCACCCTTCTGTCTATGCCACGGACCATTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGCACA
GCCGCCAACTCTTGCGCCTATCTGATTCCCCATGTCCGCCCCGGCTTCACCGTGCTCGACGTGGGCTGCGGCCCG
GGCTCCATCACCCTTGATCTCGCGCGCCTTGTGCCAGACGGCCACGTCACGGGCCTTGAAAACGTGCCCGAGCCG
CTCCATGCCGCCCGCGCCCTGGCCACTGAGCAGGCCGTCTCCAACGTGAGCTTCTGCTTGGGCGACATCCATGCC
CTGCCATTTGACAATGACTGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTGGCCGACCCCGTCGCC
GCCCTGCGCGAGATGCGTCGCGTCGCCCGCTCTGACGGCGGCATCGTTGCCTGCCGTGAGTCGGCTGCCATGACT
TGGTTTCCCGCCTCGGAGCCGCTCGAGGCCTGGCGCCGCCTGACCACGGCCATTGCCGCACACAAAGGCGGAAAC
CCACACCCAGGTGCACGCATCCACGTCTGGGCTCAACAGGCTGGCTTCTCCAGAGACAGAATCCTCAAAAGCACC
GACTCGTGGTGCTTTAGTAGCGATTCTGAGCGCGAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCGCCC
GCCTTTGTCAACATGGCCCTCGACCACGGCCACTCGACGCCCCACGAGCTGCACCTTATTGCCGCCGGCTGGGAT
GCTTTTTGTCGAGATGCAGATGCATGGTTTGGCTTGTTACATGGCCAGATTCTCTGCCGCAACTAA
Transcript >OphauG2|4723
ATGGCCGCCTCTCACCCTTCTGTCTATGCCACGGACCATTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGCACA
GCCGCCAACTCTTGCGCCTATCTGATTCCCCATGTCCGCCCCGGCTTCACCGTGCTCGACGTGGGCTGCGGCCCG
GGCTCCATCACCCTTGATCTCGCGCGCCTTGTGCCAGACGGCCACGTCACGGGCCTTGAAAACGTGCCCGAGCCG
CTCCATGCCGCCCGCGCCCTGGCCACTGAGCAGGCCGTCTCCAACGTGAGCTTCTGCTTGGGCGACATCCATGCC
CTGCCATTTGACAATGACTGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTGGCCGACCCCGTCGCC
GCCCTGCGCGAGATGCGTCGCGTCGCCCGCTCTGACGGCGGCATCGTTGCCTGCCGTGAGTCGGCTGCCATGACT
TGGTTTCCCGCCTCGGAGCCGCTCGAGGCCTGGCGCCGCCTGACCACGGCCATTGCCGCACACAAAGGCGGAAAC
CCACACCCAGGTGCACGCATCCACGTCTGGGCTCAACAGGCTGGCTTCTCCAGAGACAGAATCCTCAAAAGCACC
GACTCGTGGTGCTTTAGTAGCGATTCTGAGCGCGAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCGCCC
GCCTTTGTCAACATGGCCCTCGACCACGGCCACTCGACGCCCCACGAGCTGCACCTTATTGCCGCCGGCTGGGAT
GCTTTTTGTCGAGATGCAGATGCATGGTTTGGCTTGTTACATGGCCAGATTCTCTGCCGCAACTAA
Gene >OphauG2|4723
ATGGCCGCCTCTCACCCTTCTGTCTATGCCACGGACCATTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGCACA
GCCGCCAACTCTTGCGCCTATCTGATTCCCCATGTCCGCCCCGGCTTCACCGTGCTCGACGTGGGCTGCGGCCCG
GGCTCCATCACCCTTGATCTCGCGCGCCTTGTGCCAGACGGCCACGTCACGGGCCTTGAAAACGTGCCCGAGCCG
CTCCATGCCGCCCGCGCCCTGGCCACTGAGCAGGCCGTCTCCAACGTGAGCTTCTGCTTGGGCGACATCCATGCC
CTGCCATTTGACAATGACTGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTGGCCGACCCCGTCGCC
GCCCTGCGCGAGATGCGTCGCGTCGCCCGCTCTGACGGCGGCATCGTTGCCTGCCGTGAGTCGGCTGCCATGACT
TGGTTTCCCGCCTCGGAGCCGCTCGAGGCCTGGCGCCGCCTGACCACGGCCATTGCCGCACACAAAGGCGGAAAC
CCACACCCAGGTGCACGCATCCACGTCTGGGCTCAACAGGCTGGCTTCTCCAGAGACAGAATCCTCAAAAGCACC
GACTCGTGGTGCTTTAGTAGCGATTCTGAGCGCGAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCGCCC
GCCTTTGTCAACATGGCCCTCGACCACGGCCACTCGACGCCCCACGAGCTGCACCTTATTGCCGCCGGCTGGGAT
GCTTTTTGTCGAGATGCAGATGCATGGTTTGGCTTGTTACATGGCCAGATTCTCTGCCGCAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail