Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4722
Gene name
LocationContig_402:2867..3789
Strand+
Gene length (bp)922
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01965 DJ-1_PfpI DJ-1/PfpI family 1.5E-06 80 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8G9F9|INHA_PSEPU Isonitrile hydratase OS=Pseudomonas putida GN=inhA PE=1 SV=1 80 231 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4722
MAQPFDLGKPNRTIRVGVILMGGRTEALDVAPVDMIHSITKGFVDELPAEWLPMNIRSQAIEAEFLWVSEAGKCS
TSKLTSAMSIVTTHSFDDCPPLDVVMIGAHNFSYQPTEKELAFVRKSWESCSAFLAICGGIEVAVLAGIVGSKTA
TAPRFALESLRQRVPEATWVNKRWERDGKLWTSGTLLNGLDATSAFIQETWGKGEGSLVDYTMKLCAWPIRDGEY
GDVSWSF*
Coding >OphauG2|4722
ATGGCTCAACCGTTTGACCTCGGCAAGCCTAACAGGACCATCCGTGTAGGGGTGATTTTGATGGGAGGGCGTACA
GAGGCACTTGACGTGGCGCCTGTCGACATGATACACAGCATTACAAAGGGCTTTGTCGACGAATTGCCGGCGGAA
TGGCTTCCGATGAATATCAGGTCTCAAGCAATCGAGGCCGAGTTTCTTTGGGTGTCTGAGGCTGGGAAATGCAGC
ACCAGCAAGCTAACAAGCGCCATGTCCATTGTGACGACGCACTCCTTTGACGACTGTCCCCCTCTCGACGTGGTC
ATGATTGGTGCGCACAACTTTAGCTACCAGCCAACGGAAAAGGAGCTCGCCTTTGTGCGCAAGAGCTGGGAAAGC
TGTTCGGCTTTTCTTGCCATCTGCGGCGGGATAGAAGTCGCTGTGCTGGCGGGCATTGTAGGCAGCAAGACGGCC
ACGGCACCTCGATTTGCGCTCGAGTCTCTCCGCCAGCGGGTTCCCGAAGCAACATGGGTGAACAAGCGATGGGAG
AGAGACGGCAAGCTGTGGACCAGTGGGACTTTGCTGAATGGACTGGATGCCACGTCGGCTTTTATCCAGGAGACG
TGGGGCAAGGGAGAGGGCTCTCTGGTTGATTACACGATGAAGCTGTGTGCGTGGCCGATACGAGATGGAGAGTAT
GGGGATGTGTCGTGGTCGTTTTAG
Transcript >OphauG2|4722
ATGGCTCAACCGTTTGACCTCGGCAAGCCTAACAGGACCATCCGTGTAGGGGTGATTTTGATGGGAGGGCGTACA
GAGGCACTTGACGTGGCGCCTGTCGACATGATACACAGCATTACAAAGGGCTTTGTCGACGAATTGCCGGCGGAA
TGGCTTCCGATGAATATCAGGTCTCAAGCAATCGAGGCCGAGTTTCTTTGGGTGTCTGAGGCTGGGAAATGCAGC
ACCAGCAAGCTAACAAGCGCCATGTCCATTGTGACGACGCACTCCTTTGACGACTGTCCCCCTCTCGACGTGGTC
ATGATTGGTGCGCACAACTTTAGCTACCAGCCAACGGAAAAGGAGCTCGCCTTTGTGCGCAAGAGCTGGGAAAGC
TGTTCGGCTTTTCTTGCCATCTGCGGCGGGATAGAAGTCGCTGTGCTGGCGGGCATTGTAGGCAGCAAGACGGCC
ACGGCACCTCGATTTGCGCTCGAGTCTCTCCGCCAGCGGGTTCCCGAAGCAACATGGGTGAACAAGCGATGGGAG
AGAGACGGCAAGCTGTGGACCAGTGGGACTTTGCTGAATGGACTGGATGCCACGTCGGCTTTTATCCAGGAGACG
TGGGGCAAGGGAGAGGGCTCTCTGGTTGATTACACGATGAAGCTGTGTGCGTGGCCGATACGAGATGGAGAGTAT
GGGGATGTGTCGTGGTCGTTTTAG
Gene >OphauG2|4722
ATGGCTCAACCGTTTGACCTCGGCAAGCCTAACAGGACCATCCGTGTAGGGGTGATTTTGATGGGAGGGTAAGCC
ACCGAGTCGGAAGCCTGGCTTGCTTTGTTCTGTATAGGATGCAAGTGTCGGCGATTGACCAGGACTACAGGCGTA
CAGAGGCACTTGACGTGGCGCCTGTCGACATGATACACAGCATTACAAAGGGCTTTGTCGACGAATTGCCGGCGG
AATGGCTTCCGATGAATATCAGGTCTCAAGCAATCGAGGCCGAGTTTCTTTGGGTGTCTGAGGCTGGGAAATGCA
GCACCAGCAAGCTAACAAGCGCCATGTCCATTGTGACGACGGTAGGTGAAGCAACAGCCATGGGCTGTGGTGTGC
TCTTGTCCTAGACTCTTGTCCTAGACTCTTGTCCTAGACTCTTGTCCTAGACTCTTGTCCTAGACTCTTGTCCTA
GACTCTTGTCCTAGTACTGATGCTCGGTCCTCGACAGCACTCCTTTGACGACTGTCCCCCTCTCGACGTGGTCAT
GATTGGTGCGCACAACTTTAGCTACCAGCCAACGGAAAAGGAGCTCGCCTTTGTGCGCAAGAGCTGGGAAAGCTG
TTCGGCTTTTCTTGCCATCTGCGGCGGGATAGAAGTCGCTGTGCTGGCGGGCATTGTAGGCAGCAAGACGGCCAC
GGCACCTCGATTTGCGCTCGAGTCTCTCCGCCAGCGGGTTCCCGAAGCAACATGGGTGAACAAGCGATGGGAGAG
AGACGGCAAGCTGTGGACCAGTGGGACTTTGCTGAATGGACTGGATGCCACGTCGGCTTTTATCCAGGAGACGTG
GGGCAAGGGAGAGGGCTCTCTGGTTGATTACACGATGAAGCTGTGTGCGTGGCCGATACGAGATGGAGAGTATGG
GGATGTGTCGTGGTCGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail