Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4709
Gene name
LocationContig_400:8464..9554
Strand-
Gene length (bp)1090
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09174 Maf1 Maf1 regulator 8.7E-58 25 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14109|MAF1_SCHPO Repressor of RNA polymerase III transcription maf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=maf1 PE=1 SV=5 1 222 4.0E-43
sp|Q6PGU2|MAF1_DANRE Repressor of RNA polymerase III transcription MAF1 homolog OS=Danio rerio GN=maf1 PE=2 SV=1 1 230 1.0E-28
sp|Q7ZWL6|MAF1_XENLA Repressor of RNA polymerase III transcription MAF1 homolog OS=Xenopus laevis GN=maf1 PE=2 SV=1 1 227 2.0E-27
sp|A5D9C6|MAF1_BOVIN Repressor of RNA polymerase III transcription MAF1 homolog OS=Bos taurus GN=MAF1 PE=2 SV=1 1 227 8.0E-27
sp|Q9D0U6|MAF1_MOUSE Repressor of RNA polymerase III transcription MAF1 homolog OS=Mus musculus GN=Maf1 PE=2 SV=1 1 227 8.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14109|MAF1_SCHPO Repressor of RNA polymerase III transcription maf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=maf1 PE=1 SV=5 1 222 4.0E-43
sp|Q6PGU2|MAF1_DANRE Repressor of RNA polymerase III transcription MAF1 homolog OS=Danio rerio GN=maf1 PE=2 SV=1 1 230 1.0E-28
sp|Q7ZWL6|MAF1_XENLA Repressor of RNA polymerase III transcription MAF1 homolog OS=Xenopus laevis GN=maf1 PE=2 SV=1 1 227 2.0E-27
sp|A5D9C6|MAF1_BOVIN Repressor of RNA polymerase III transcription MAF1 homolog OS=Bos taurus GN=MAF1 PE=2 SV=1 1 227 8.0E-27
sp|Q9D0U6|MAF1_MOUSE Repressor of RNA polymerase III transcription MAF1 homolog OS=Mus musculus GN=Maf1 PE=2 SV=1 1 227 8.0E-27
sp|Q5XIH0|MAF1_RAT Repressor of RNA polymerase III transcription MAF1 homolog OS=Rattus norvegicus GN=Maf1 PE=2 SV=1 1 227 9.0E-27
sp|Q9H063|MAF1_HUMAN Repressor of RNA polymerase III transcription MAF1 homolog OS=Homo sapiens GN=MAF1 PE=1 SV=2 1 227 1.0E-26
sp|Q54Y76|MAF1_DICDI Repressor of RNA polymerase III transcription OS=Dictyostelium discoideum GN=maf1 PE=3 SV=1 1 262 3.0E-20
sp|Q6FIZ7|MAF1_CANGA Repressor of RNA polymerase III transcription MAF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MAF1 PE=3 SV=1 84 224 6.0E-20
sp|Q757K3|MAF1_ASHGO Repressor of RNA polymerase III transcription MAF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MAF1 PE=3 SV=1 73 229 4.0E-19
sp|P41910|MAF1_YEAST Repressor of RNA polymerase III transcription MAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAF1 PE=1 SV=1 89 233 2.0E-18
sp|P41910|MAF1_YEAST Repressor of RNA polymerase III transcription MAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAF1 PE=1 SV=1 1 53 9.0E-10
sp|Q6FIZ7|MAF1_CANGA Repressor of RNA polymerase III transcription MAF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MAF1 PE=3 SV=1 1 53 3.0E-09
sp|Q757K3|MAF1_ASHGO Repressor of RNA polymerase III transcription MAF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MAF1 PE=3 SV=1 1 53 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016480 negative regulation of transcription by RNA polymerase III Yes
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031327 negative regulation of cellular biosynthetic process No
GO:0051172 negative regulation of nitrogen compound metabolic process No
GO:0045892 negative regulation of transcription, DNA-templated No
GO:0008150 biological_process No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0031323 regulation of cellular metabolic process No
GO:0050789 regulation of biological process No
GO:1902679 negative regulation of RNA biosynthetic process No
GO:0009892 negative regulation of metabolic process No
GO:0048519 negative regulation of biological process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050794 regulation of cellular process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0051253 negative regulation of RNA metabolic process No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:0010558 negative regulation of macromolecule biosynthetic process No
GO:0048523 negative regulation of cellular process No
GO:1903507 negative regulation of nucleic acid-templated transcription No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0006359 regulation of transcription by RNA polymerase III No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009890 negative regulation of biosynthetic process No
GO:0045934 negative regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031324 negative regulation of cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3553
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4709 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2831
Ophiocordyceps camponoti-floridani Ophcf2|00769
Ophiocordyceps camponoti-rufipedis Ophun1|6354
Ophiocordyceps kimflemingae Ophio5|4774
Ophiocordyceps subramaniannii Hirsu2|6819

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4709
MKYLPAQGFEAVTSALNFNTPDCNVTGSCDLYTTKSTGSDKKLYKSIDRDLESQHASLLKLGASLSPPDREEMLA
TSSSMQLFLNSSAFGPLSQISSRRAFAYLIATLNASHPHYDFSHVLRPDEFKRERNLRRVMINLDSILQNVRPGS
EARSLDSSSLGGDPNSVWGPQCWSLIDKEMHLSDCTMFSYHPDPDPFEEDESAIWAAHYFFFNRTLKRVAYLYVR
VVPVISSTSPTLRPLGSSHKRPHCDVESHEASKRARFCLNEDAESMTPGDNEDDDGLFWNRGEDGDIVPFSDDDW
RDNDGNAYDEVDNPEAGNDSREFASGERLMNEEIAGQMEI*
Coding >OphauG2|4709
ATGAAGTACTTACCCGCTCAAGGATTTGAGGCTGTGACTAGTGCTCTCAACTTCAATACACCAGACTGCAACGTT
ACTGGCAGCTGCGATCTTTATACCACCAAATCTACGGGCTCCGACAAGAAACTCTATAAAAGCATCGACAGAGAC
CTCGAGTCACAGCATGCCTCTCTACTCAAGCTGGGCGCGAGCCTATCCCCACCCGACCGCGAAGAGATGCTGGCC
ACATCGAGCAGCATGCAACTCTTTTTAAATTCGAGCGCTTTTGGTCCCCTGTCGCAAATATCAAGCCGTCGCGCA
TTTGCCTACCTCATTGCCACGCTTAATGCCAGTCACCCCCACTATGACTTTTCCCACGTCCTCAGACCCGACGAA
TTCAAGCGCGAGCGCAACTTGCGGCGAGTCATGATCAACCTCGACTCAATCTTACAAAATGTGCGGCCTGGGTCC
GAAGCCAGATCGCTTGATTCATCATCACTTGGCGGCGATCCGAATTCAGTCTGGGGCCCGCAGTGCTGGTCCCTC
ATTGACAAGGAGATGCACCTCAGTGACTGCACCATGTTCAGTTACCATCCAGACCCTGATCCTTTTGAAGAGGAC
GAGAGCGCCATCTGGGCCGCACACTACTTCTTCTTTAACCGAACCCTCAAGCGAGTTGCCTACCTCTATGTGCGC
GTGGTCCCCGTCATTTCGTCGACGAGTCCAACCTTGCGACCCTTGGGAAGCAGCCACAAGCGCCCACACTGTGAT
GTAGAATCACACGAAGCTAGCAAGCGTGCCCGATTTTGCTTAAATGAAGATGCCGAGTCCATGACTCCTGGTGAC
AATGAAGATGACGACGGGCTGTTTTGGAACCGCGGAGAGGACGGGGATATTGTTCCCTTTTCTGATGACGATTGG
CGAGACAATGACGGCAACGCATACGATGAAGTCGATAATCCCGAGGCTGGCAATGACAGCCGCGAGTTTGCAAGT
GGCGAGAGATTGATGAATGAAGAGATTGCCGGCCAAATGGAAATTTGA
Transcript >OphauG2|4709
ATGAAGTACTTACCCGCTCAAGGATTTGAGGCTGTGACTAGTGCTCTCAACTTCAATACACCAGACTGCAACGTT
ACTGGCAGCTGCGATCTTTATACCACCAAATCTACGGGCTCCGACAAGAAACTCTATAAAAGCATCGACAGAGAC
CTCGAGTCACAGCATGCCTCTCTACTCAAGCTGGGCGCGAGCCTATCCCCACCCGACCGCGAAGAGATGCTGGCC
ACATCGAGCAGCATGCAACTCTTTTTAAATTCGAGCGCTTTTGGTCCCCTGTCGCAAATATCAAGCCGTCGCGCA
TTTGCCTACCTCATTGCCACGCTTAATGCCAGTCACCCCCACTATGACTTTTCCCACGTCCTCAGACCCGACGAA
TTCAAGCGCGAGCGCAACTTGCGGCGAGTCATGATCAACCTCGACTCAATCTTACAAAATGTGCGGCCTGGGTCC
GAAGCCAGATCGCTTGATTCATCATCACTTGGCGGCGATCCGAATTCAGTCTGGGGCCCGCAGTGCTGGTCCCTC
ATTGACAAGGAGATGCACCTCAGTGACTGCACCATGTTCAGTTACCATCCAGACCCTGATCCTTTTGAAGAGGAC
GAGAGCGCCATCTGGGCCGCACACTACTTCTTCTTTAACCGAACCCTCAAGCGAGTTGCCTACCTCTATGTGCGC
GTGGTCCCCGTCATTTCGTCGACGAGTCCAACCTTGCGACCCTTGGGAAGCAGCCACAAGCGCCCACACTGTGAT
GTAGAATCACACGAAGCTAGCAAGCGTGCCCGATTTTGCTTAAATGAAGATGCCGAGTCCATGACTCCTGGTGAC
AATGAAGATGACGACGGGCTGTTTTGGAACCGCGGAGAGGACGGGGATATTGTTCCCTTTTCTGATGACGATTGG
CGAGACAATGACGGCAACGCATACGATGAAGTCGATAATCCCGAGGCTGGCAATGACAGCCGCGAGTTTGCAAGT
GGCGAGAGATTGATGAATGAAGAGATTGCCGGCCAAATGGAAATTTGA
Gene >OphauG2|4709
ATGAAGGTAAAAGGCGGCTTTCTTGCGGCGATGCACCCACGGCTTGTTACTGACGTATTCCCCTGGCACCCAGTA
CTTACCCGCTCAAGGATTTGAGGCTGTGACTAGTGCTCTCAACTTCAATACACCAGACTGCAACGTTACTGGCAG
CTGCGATCTTTATACCACCAAATCTACGGGCTCCGACAAGAAACTCTATAAAAGCATCGACAGAGACCTCGAGTC
ACAGCATGCCTCTCTACTCAAGCTGGGCGCGAGCCTATCCCCACCCGACCGCGAAGAGATGCTGGCCACATCGAG
CAGCATGCAACTCTTTTTAAATTCGAGCGCTTTTGGTCCCCTGTCGCAAATATCAAGCCGTCGCGCATTTGCCTA
CCTCATTGCCACGCTTAATGCCAGTCACCCCCACTATGACTTTTCCCACGTCCTCAGACCCGACGAATTCAAGCG
CGAGCGCAACTTGCGGCGAGTCATGATCAACCTCGACTCAATCTTACAAAATGTGCGGCCTGGGTCCGAAGCCAG
ATCGCTTGATTCATCATCACTTGGCGGCGATCCGAATTCAGTCTGGGGCCCGCAGTGCTGGTCCCTCATTGACAA
GGAGATGCACCTCAGTGACTGCACCATGTTCAGTTACCATCCAGACCCTGATCCTTTTGAAGAGGACGAGAGCGC
CATCTGGGCCGCACACTACTTCTTCTTTAACCGAACCCTCAAGCGAGTTGCCTACCTCTATGTGCGCGTGGTCCC
CGTCATTTCGTCGACGAGTCCAACCTTGCGACCCTTGGGAAGCAGCCACAAGCGCCCACACTGTGATGTAGAATC
ACACGAAGCTAGCAAGCGTGCCCGATTTTGCTTAAATGAAGATGCCGAGTCCATGACTCCTGGTGACAATGAAGA
TGACGACGGGCTGTTTTGGAACCGCGGAGAGGACGGGGATATTGTTCCCTTTTCTGATGACGATTGGCGAGACAA
TGACGGCAACGCATACGATGAAGTCGATAATCCCGAGGCTGGCAATGACAGCCGCGAGTTTGCAAGTGGCGAGAG
ATTGATGAATGAAGAGATTGCCGGCCAAATGGAAATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail