Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4688
Gene name
LocationContig_40:4264..4530
Strand+
Gene length (bp)266
Transcript length (bp)213
Coding sequence length (bp)213
Protein length (aa) 71

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5999
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4688 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3197
Ophiocordyceps subramaniannii Hirsu2|1065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4688
MAQLLLRQGNGKQSNDRRLNGLEHLAAMGEEVGVAKEIMWPGQVHSAEHNHQTSQWYYLVNTSSTERDKS*
Coding >OphauG2|4688
ATGGCCCAGCTTCTGTTGAGGCAGGGGAACGGGAAACAATCAAACGACAGACGTCTCAATGGTCTTGAGCATCTT
GCTGCCATGGGCGAGGAGGTTGGTGTCGCCAAGGAAATCATGTGGCCAGGCCAAGTGCACTCGGCAGAGCACAAC
CATCAGACGTCTCAATGGTATTACCTCGTAAACACCTCGAGCACCGAGAGAGACAAGAGCTGA
Transcript >OphauG2|4688
ATGGCCCAGCTTCTGTTGAGGCAGGGGAACGGGAAACAATCAAACGACAGACGTCTCAATGGTCTTGAGCATCTT
GCTGCCATGGGCGAGGAGGTTGGTGTCGCCAAGGAAATCATGTGGCCAGGCCAAGTGCACTCGGCAGAGCACAAC
CATCAGACGTCTCAATGGTATTACCTCGTAAACACCTCGAGCACCGAGAGAGACAAGAGCTGA
Gene >OphauG2|4688
ATGGCCCAGCTTCTGTTGAGGCAGGGGAACGGGAAACAATCAAACGACAGACGTCTCAATGGTATGTACCTCGTC
AACACCTCGAGCACCGAGACAAGGCCTGAATAGGGACAGGTCTTGAGCATCTTGCTGCCATGGGCGAGGAGGTTG
GTGTCGCCAAGGAAATCATGTGGCCAGGCCAAGTGCACTCGGCAGAGCACAACCATCAGACGTCTCAATGGTATT
ACCTCGTAAACACCTCGAGCACCGAGAGAGACAAGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail